Recombinant Human MIF protein, His-tagged
| Cat.No. : | MIF-23H |
| Product Overview : | Recombinant Human MIF protein, fused to His-tag at C-terminus, was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Citation
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 123 |
| Description : | Migration Inhibitory Factor (MIF) is a secreted protein without a cleavable signal sequence and is secreted via a specialized, non-classical pathway. It is secreted by macrophages upon stimulation by bacterial lipopolysaccharide (LPS), or by M.tuberculosis antigens. MIF consists of two α-helices and six β-strands, four of which form a β-sheet. The two remaining β-strands interact with other MIF molecules, creating a trimer. Structure-function studies suggest MIF is bifunctional with segregated topology. The N- and C-termini mediate enzyme activity (in theory). Phenylpyruvate tautomerase activity (enol-to-keto) has been demonstrated and is dependent upon Pro at position 1. Amino acids 50-65(a.a.) have also been suggested to contain thiol-protein oxidoreductase activity. MIF has proinflammatory cytokine activity centered around (a.a.) 49 - 65. On fibroblasts, MIF induces, IL-1, IL-8 and MMP expression; on macrophages, MIF stimulates NO production and TNF-α release folllowing IFN-γ activation. MIF apparently acts through CD74 and CD44, likely in some form of trimeric interaction. Human MIF is active on mouse cells. Human MIF is 90%, 94%, 95%, and 90% aa identical to mouse, bovine, porcine and rat MIF, respectively. |
| Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
| Bio-activity : | Fully biologically active when compared to standard. The specific activity is determined by binding rhCD74 in a functional ELISA. |
| Molecular Mass : | Approximately 13.5 kDa, a single non-glycosylated polypeptide chain containing 117 amino acids, with 6 × His at the C-terminus. |
| AA Sequence : | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFALEHHHHHH |
| Endotoxin : | Less than 1 EU/µg of rHuMIF, His as determined by LAL method. |
| Purity : | >95% by SDS-PAGE and HPLC analysis. |
| Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
| Gene Name | MIF |
| Official Symbol | MIF |
| Synonyms | MIF; macrophage migration inhibitory factor (glycosylation-inhibiting factor); GLIF; macrophage migration inhibitory factor; GIF; L-dopachrome isomerase; L-dopachrome tautomerase; phenylpyruvate tautomerase; MMIF; |
| Gene ID | 4282 |
| mRNA Refseq | NM_002415 |
| Protein Refseq | NP_002406 |
| MIM | 153620 |
| UniProt ID | P14174 |
| ◆ Recombinant Proteins | ||
| Mif-331M | Recombinant Mouse Mif Protein (115 aa) | +Inquiry |
| Mif-5189M | Recombinant Mouse Mif protein | +Inquiry |
| MIF-3847Z | Recombinant Zebrafish MIF | +Inquiry |
| MIF-650H | Active Recombinant Human MIF, His-tagged | +Inquiry |
| MIF-218H | Recombinant Human MIF Protein (Met1-Ala115), C-His tagged, Animal-free, Carrier-free | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MIF-1884MCL | Recombinant Mouse MIF cell lysate | +Inquiry |
| MIF-1917HCL | Recombinant Human MIF cell lysate | +Inquiry |
First evidence that oligopyridines, α-helix foldamers, inhibit Mcl-1 and sensitize ovarian carcinoma cells to Bcl-xL-targeting strategies.
Journal: Journal of medicinal chemistry PubMed ID: 25585174 Data: 2015/5/7
Authors: Céline Gloaguen, Anne Sophie Voisin-Chiret, Laurent Poulain
Article Snippet:Capture of His-Bcl-xL (same condition as His-Mcl-1) was performed on channel Fc1 that was used as a reference surface for nonspecific binding measurements.Capture of His-Bcl-xL (same condition as His-Mcl-1) was performed on channel Fc1 that was used as a reference surface for nonspecific binding measurements.. Recombinant human Mcl-1 protein, fused to His-tag, and recombinant human Bcl-xL, His-tagged (DNA sequence encoding the human BCL2L1 isoform 1 (Met 1?Arg 212) fused with a polyhistidine tag at the C-terminus) were purchased from Creative BioMart (45?16 Ramsey Road, Shirley, NY 11967, USA). . A lowmass weight-single-cycle kinetics (LMW-SCK) analysis to determine association, dissociation, and affinity constants (ka, kd, and Kd respectively) was carried out by injecting different protein concentrations.A lowmass weight-single-cycle kinetics (LMW-SCK) analysis to determine association, dissociation, and affinity constants (ka, kd, and Kd respectively) was carried out by injecting different protein concentrations.
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MIF Products
Required fields are marked with *
My Review for All MIF Products
Required fields are marked with *
