Recombinant Human MIIP, His-tagged

• Cat.No.: MIIP-141H
• Product Overview: Recombinant Human Migration and Invasion-Inhibitory Protein/MIIP is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Pro388) of Human MIIP fused with a polyhistidine tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 1-388 a.a.
• Description: Migration and Invasion-Inhibitory Protein (MIIP) was initially discovered in a yeast two-hybrid screen for proteins that interact with and inhibit the migration and invasion-promoting protein insulin-like growth factor binding protein 2 (IGFBP2). It is reported that MIIP not only modulates IGFBP2 but also regulates microtubule by binding to and inhibiting HDAC6, a class 2 histone deacetylase that deacetylates α-tubulin, heat-shock protein 90 (HSP90), and cortactin. In addition, MIIP also regulates the mitosis checkpoint, another microtubule-associated process.
• AA Sequence: MVEAEELAQLRLLNLELLRQLWVGQDAVRRSVARAASESSLESSSSYNSETPSTPETSSTSLSTS CPRGRSSVWGPPDACRGDLRDVARSGVASLPPANCQHQESLGRPRPHSAPSLGTSSLRDPEPSGR LGDPGPQEAQTSRSILAQQSKLSKPRVTFSEESAVPERSWRLRPYLGYDWIAGSLDTSSSITSQP EAFFSKLQEFRETNKEECICSHPEPQLPGLRESSGSGVEEDHECVYCYRVNRRLFPVPVDPGTPC RLCRTPRDQQGPGTLAQPAHVRVSIPLSILEPPHRYHIHRRKSFDASDTLALPRHCLLGWDIFPP KSEKSSAPRNLDLWSSVSAEAQHQKLSGTSSPFHPASPMQMLPPTPTWSVPQVPRPHVPRQKPVD HHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.

Gene Information

• Gene Name: MIIP migration and invasion inhibitory protein [ Homo sapiens ]
• Official Symbol: MIIP
• Synonyms: MIIP; migration and invasion inhibitory protein; migration and invasion-inhibitory protein; FLJ12438; IIp45; invasion inhibitory protein 45; IGFBP2-binding protein; invasion-inhibitory protein 45; IIP45; RP5-1077B9.4; FLJ38609
• Gene ID: 60672
• mRNA Refseq: NM_021933
• Protein Refseq: NP_068752
• MIM: 608772
• UniProt ID: Q5JXC2
• Chromosome Location: 1p36.22