Recombinant Human MIIP, His-tagged
Cat.No. : | MIIP-141H |
Product Overview : | Recombinant Human Migration and Invasion-Inhibitory Protein/MIIP is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Pro388) of Human MIIP fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 1-388 a.a. |
Description : | Migration and Invasion-Inhibitory Protein (MIIP) was initially discovered in a yeast two-hybrid screen for proteins that interact with and inhibit the migration and invasion-promoting protein insulin-like growth factor binding protein 2 (IGFBP2). It is reported that MIIP not only modulates IGFBP2 but also regulates microtubule by binding to and inhibiting HDAC6, a class 2 histone deacetylase that deacetylates α-tubulin, heat-shock protein 90 (HSP90), and cortactin. In addition, MIIP also regulates the mitosis checkpoint, another microtubule-associated process. |
AA Sequence : | MVEAEELAQLRLLNLELLRQLWVGQDAVRRSVARAASESSLESSSSYNSETPSTPETSSTSLSTS CPRGRSSVWGPPDACRGDLRDVARSGVASLPPANCQHQESLGRPRPHSAPSLGTSSLRDPEPSGR LGDPGPQEAQTSRSILAQQSKLSKPRVTFSEESAVPERSWRLRPYLGYDWIAGSLDTSSSITSQP EAFFSKLQEFRETNKEECICSHPEPQLPGLRESSGSGVEEDHECVYCYRVNRRLFPVPVDPGTPC RLCRTPRDQQGPGTLAQPAHVRVSIPLSILEPPHRYHIHRRKSFDASDTLALPRHCLLGWDIFPP KSEKSSAPRNLDLWSSVSAEAQHQKLSGTSSPFHPASPMQMLPPTPTWSVPQVPRPHVPRQKPVD HHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | MIIP migration and invasion inhibitory protein [ Homo sapiens ] |
Official Symbol | MIIP |
Synonyms | MIIP; migration and invasion inhibitory protein; migration and invasion-inhibitory protein; FLJ12438; IIp45; invasion inhibitory protein 45; IGFBP2-binding protein; invasion-inhibitory protein 45; IIP45; RP5-1077B9.4; FLJ38609; |
Gene ID | 60672 |
mRNA Refseq | NM_021933 |
Protein Refseq | NP_068752 |
MIM | 608772 |
UniProt ID | Q5JXC2 |
Chromosome Location | 1p36.22 |
◆ Recombinant Proteins | ||
MIIP-6601HF | Recombinant Full Length Human MIIP Protein, GST-tagged | +Inquiry |
MIIP-141H | Recombinant Human MIIP, His-tagged | +Inquiry |
MIIP-9841M | Recombinant Mouse MIIP Protein | +Inquiry |
MIIP-5560M | Recombinant Mouse MIIP Protein, His (Fc)-Avi-tagged | +Inquiry |
MIIP-2100H | Recombinant Human MIIP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
MIIP-4314HCL | Recombinant Human MIIP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIIP Products
Required fields are marked with *
My Review for All MIIP Products
Required fields are marked with *
0
Inquiry Basket