Recombinant Human MINPP1 Protein (31-487 aa), His-tagged
Cat.No. : | MINPP1-1730H |
Product Overview : | Recombinant Human MINPP1 Protein (31-487 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 31-487 aa |
Description : | Acts as a phosphoinositide 5- and phosphoinositide 6-phosphatase and regulates cellular levels of inositol pentakisphosphate (InsP5) and inositol hexakisphosphate (InsP6). Also acts as a 2,3-bisphosphoglycerate 3-phosphatase, by mediating the dephosphorylation of 2,3-bisphosphoglycerate (2,3-BPG) to produce phospho-D-glycerate without formation of 3-phosphoglycerate. May play a role in bone development (endochondral ossification). |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 54.1 kDa |
AA Sequence : | SLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPEAPWRDPELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKQRSQPISSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKKQMHRKFRSGLIVPYASNLIFVLYHCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEECELARANSTSDEL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | MINPP1 multiple inositol-polyphosphate phosphatase 1 [ Homo sapiens ] |
Official Symbol | MINPP1 |
Synonyms | MINPP1; MIPP; HIPER1; MINPP2; DKFZp564L2016; |
Gene ID | 9562 |
mRNA Refseq | NM_001178117 |
Protein Refseq | NP_001171588 |
MIM | 605391 |
UniProt ID | Q9UNW1 |
◆ Recombinant Proteins | ||
MINPP1-9847M | Recombinant Mouse MINPP1 Protein | +Inquiry |
MINPP1-1158H | Recombinant Human MINPP1 Protein (31-487 aa), GST-tagged | +Inquiry |
MINPP1-880HFL | Recombinant Full Length Human MINPP1 Protein, C-Flag-tagged | +Inquiry |
MINPP1-6265HF | Recombinant Full Length Human MINPP1 Protein, GST-tagged | +Inquiry |
MINPP1-548H | Recombinant Human MINPP1 Protein, DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MINPP1-4312HCL | Recombinant Human MINPP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MINPP1 Products
Required fields are marked with *
My Review for All MINPP1 Products
Required fields are marked with *
0
Inquiry Basket