Recombinant Human MIP Protein

Cat.No. : MIP-5347H
Product Overview : Human MIP full-length ORF (ADR82888.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : Major intrinsic protein is a member of the water-transporting aquaporins as well as the original member of the MIP family of channel proteins. The function of the fiber cell membrane protein encoded by this gene is undetermined, yet this protein is speculated to play a role in intracellular communication. The MIP protein is expressed in the ocular lens and is required for correct lens function. This gene has been mapped among aquaporins AQP2, AQP5, and AQP6, in a potential gene cluster at 12q13. [provided by RefSeq
Form : Liquid
Molecular Mass : 29 kDa
AA Sequence : MWELRSASFWRAIFAEFFATLFYVFFGLGSSLRWAPGPLHVLQVAMAFGLALATLVQSVGHISGAHVNPAVTFAFLVGSQMSLLRAFCYMAAQLLGAVAGAAVLYSVTPPAVRGNLALNTLHPAVSVGQATTVEIFLTLQFVLCIFATYDERRNGQLGSVALAVGFSLALGHLFGMYYTGAGMNPARSFAPAILTGNFTNHWVYWVGPIIGGGLGSLLYDFLLFPRLKSISERLSVLKGAKPDVSNGQPEVTGEPVELNTQAL
Applications : Antibody Production
Functional Study
Compound Screening
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name MIP major intrinsic protein of lens fiber [ Homo sapiens ]
Official Symbol MIP
Synonyms MIP; major intrinsic protein of lens fiber; lens fiber major intrinsic protein; AQP0; aquaporin 0; LIM1; MP26; MIP26;
Gene ID 4284
mRNA Refseq NM_012064
Protein Refseq NP_036196
UniProt ID P30301

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MIP Products

Required fields are marked with *

My Review for All MIP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon