Recombinant Human MIP Protein
Cat.No. : | MIP-5347H |
Product Overview : | Human MIP full-length ORF (ADR82888.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | Major intrinsic protein is a member of the water-transporting aquaporins as well as the original member of the MIP family of channel proteins. The function of the fiber cell membrane protein encoded by this gene is undetermined, yet this protein is speculated to play a role in intracellular communication. The MIP protein is expressed in the ocular lens and is required for correct lens function. This gene has been mapped among aquaporins AQP2, AQP5, and AQP6, in a potential gene cluster at 12q13. [provided by RefSeq |
Form : | Liquid |
Molecular Mass : | 29 kDa |
AA Sequence : | MWELRSASFWRAIFAEFFATLFYVFFGLGSSLRWAPGPLHVLQVAMAFGLALATLVQSVGHISGAHVNPAVTFAFLVGSQMSLLRAFCYMAAQLLGAVAGAAVLYSVTPPAVRGNLALNTLHPAVSVGQATTVEIFLTLQFVLCIFATYDERRNGQLGSVALAVGFSLALGHLFGMYYTGAGMNPARSFAPAILTGNFTNHWVYWVGPIIGGGLGSLLYDFLLFPRLKSISERLSVLKGAKPDVSNGQPEVTGEPVELNTQAL |
Applications : | Antibody Production Functional Study Compound Screening |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | MIP major intrinsic protein of lens fiber [ Homo sapiens ] |
Official Symbol | MIP |
Synonyms | MIP; major intrinsic protein of lens fiber; lens fiber major intrinsic protein; AQP0; aquaporin 0; LIM1; MP26; MIP26; |
Gene ID | 4284 |
mRNA Refseq | NM_012064 |
Protein Refseq | NP_036196 |
UniProt ID | P30301 |
◆ Cell & Tissue Lysates | ||
MIP-410HCL | Recombinant Human MIP lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MIP Products
Required fields are marked with *
My Review for All MIP Products
Required fields are marked with *