Recombinant Human MKLN1
Cat.No. : | MKLN1-30244TH |
Product Overview : | Recombinant fragment corresponding to amino acids 633-735 of Human Mkln1 with an N terminal proprietary tag; Predicted MWt 36.96 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 103 amino acids |
Description : | Muskelin is an intracellular protein that acts as a mediator of cell spreading and cytoskeletal responses to the extracellular matrix component thrombospondin I (MIM 188060) (Adams et al. |
Molecular Weight : | 36.960kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RHCKYLIRKHRFEEKAQVDPLSALKYLQNDLYITVDHSDP EETKEFQLLASALFKSGSDFTALGFSDVDHTYAQRTQLFD TLVNFFPDSMTPPKGNLVDLITL |
Gene Name | MKLN1 muskelin 1, intracellular mediator containing kelch motifs [ Homo sapiens ] |
Official Symbol | MKLN1 |
Synonyms | MKLN1; muskelin 1, intracellular mediator containing kelch motifs; muskelin; TWA2; |
Gene ID | 4289 |
mRNA Refseq | NM_001145354 |
Protein Refseq | NP_001138826 |
MIM | 605623 |
Uniprot ID | Q9UL63 |
Chromosome Location | 7q32 |
◆ Recombinant Proteins | ||
MKLN1-3351R | Recombinant Rat MKLN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MKLN1-2599R | Recombinant Rhesus Macaque MKLN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MKLN1-2472C | Recombinant Chicken MKLN1 | +Inquiry |
MKLN1-2778R | Recombinant Rhesus monkey MKLN1 Protein, His-tagged | +Inquiry |
Mkln1-4082M | Recombinant Mouse Mkln1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MKLN1-4304HCL | Recombinant Human MKLN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MKLN1 Products
Required fields are marked with *
My Review for All MKLN1 Products
Required fields are marked with *