Recombinant Human MKLN1
| Cat.No. : | MKLN1-30244TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 633-735 of Human Mkln1 with an N terminal proprietary tag; Predicted MWt 36.96 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 103 amino acids |
| Description : | Muskelin is an intracellular protein that acts as a mediator of cell spreading and cytoskeletal responses to the extracellular matrix component thrombospondin I (MIM 188060) (Adams et al. |
| Molecular Weight : | 36.960kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | RHCKYLIRKHRFEEKAQVDPLSALKYLQNDLYITVDHSDP EETKEFQLLASALFKSGSDFTALGFSDVDHTYAQRTQLFD TLVNFFPDSMTPPKGNLVDLITL |
| Gene Name | MKLN1 muskelin 1, intracellular mediator containing kelch motifs [ Homo sapiens ] |
| Official Symbol | MKLN1 |
| Synonyms | MKLN1; muskelin 1, intracellular mediator containing kelch motifs; muskelin; TWA2; |
| Gene ID | 4289 |
| mRNA Refseq | NM_001145354 |
| Protein Refseq | NP_001138826 |
| MIM | 605623 |
| Uniprot ID | Q9UL63 |
| Chromosome Location | 7q32 |
| ◆ Recombinant Proteins | ||
| MKLN1-9863M | Recombinant Mouse MKLN1 Protein | +Inquiry |
| MKLN1-11970Z | Recombinant Zebrafish MKLN1 | +Inquiry |
| MKLN1-5364H | Recombinant Human MKLN1 Protein, GST-tagged | +Inquiry |
| MKLN1-4003H | Recombinant Human MKLN1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MKLN1-2472C | Recombinant Chicken MKLN1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MKLN1-4304HCL | Recombinant Human MKLN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MKLN1 Products
Required fields are marked with *
My Review for All MKLN1 Products
Required fields are marked with *
