Recombinant Human MKX Protein, GST-tagged

Cat.No. : MKX-433H
Product Overview : Human C10orf48 partial ORF ( NP_775847, 1 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MKX is a member of an Iroquois (IRX) family-related class of three-amino acid loop extension (TALE) atypical homeobox proteins characterized by 3 additional amino acids in the loop region between helix I and helix II of the homeodomain (Anderson et al., 2006 [PubMed 16408284]).
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.19 kDa
AA Sequence : MNTIVFNKLSSAVLFEDGGASERERGGRPYSGVLDSPHARPEVGIPDGPPLKDNLGLRHRRTGARQNGGKVRHKRQALQDMARPLKQWLYKHRDN
Quality Control Test : 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MKX mohawk homeobox [ Homo sapiens ]
Official Symbol MKX
Synonyms MKX; mohawk homeobox; C10orf48, chromosome 10 open reading frame 48 , iroquois homeobox protein like 1 , IRXL1; homeobox protein Mohawk; MGC39616; iroquois homeobox protein-like 1; Iroquois family related homeodomain protein; IFRX; IRXL1; C10orf48;
Gene ID 283078
mRNA Refseq NM_001242702
Protein Refseq NP_001229631
MIM 601332
UniProt ID Q8IYA7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MKX Products

Required fields are marked with *

My Review for All MKX Products

Required fields are marked with *

0

Inquiry Basket

cartIcon