Recombinant Human MKX Protein, GST-tagged

• Cat.No.: MKX-433H
• Product Overview: Human C10orf48 partial ORF ( NP_775847, 1 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: MKX is a member of an Iroquois (IRX) family-related class of three-amino acid loop extension (TALE) atypical homeobox proteins characterized by 3 additional amino acids in the loop region between helix I and helix II of the homeodomain (Anderson et al., 2006 [PubMed 16408284]).
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.19 kDa
• AA Sequence: MNTIVFNKLSSAVLFEDGGASERERGGRPYSGVLDSPHARPEVGIPDGPPLKDNLGLRHRRTGARQNGGKVRHKRQALQDMARPLKQWLYKHRDN
• Quality Control Test: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MKX mohawk homeobox [ Homo sapiens ]
• Official Symbol: MKX
• Synonyms: MKX; mohawk homeobox; C10orf48, chromosome 10 open reading frame 48 , iroquois homeobox protein like 1 , IRXL1; homeobox protein Mohawk; MGC39616; iroquois homeobox protein-like 1; Iroquois family related homeodomain protein; IFRX; IRXL1; C10orf48
• Gene ID: 283078
• mRNA Refseq: NM_001242702
• Protein Refseq: NP_001229631
• MIM: 601332
• UniProt ID: Q8IYA7