Recombinant Human MLF1 protein, GST-tagged
Cat.No. : | MLF1-3229H |
Product Overview : | Recombinant Human MLF1 protein(P58340)(1-268aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-268aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 57.6 kDa |
AA Sequence : | MFRMLNSSFEDDPFFSESILAHRENMRQMIRSFSEPFGRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVSSFQTMDQMVSNMRNYMQKLERNFGQLSVDPNGHSFCSSSVMTYSKIGDEPPKVFQASTQTRRAPGGIKETRKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEVNQEFINMNESDAHAFDEEWQSEVLKYKPGRHNLGNTRMRSVGHENPGSRELKRREKPQQSPAIEHGRRSNVLGDKLHIKGSSVKSNKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | MLF1 myeloid leukemia factor 1 [ Homo sapiens ] |
Official Symbol | MLF1 |
Synonyms | MLF1; myeloid leukemia factor 1; myeloid leukemia factor 1 variant 1; myeloid leukemia factor 1 variant 2; myeloid leukemia factor 1 variant 3; myelodysplasia-myeloid leukemia factor 1; |
Gene ID | 4291 |
mRNA Refseq | NM_001130156 |
Protein Refseq | NP_001123628 |
MIM | 601402 |
UniProt ID | P58340 |
◆ Recombinant Proteins | ||
MLF1-2390H | Recombinant Human MLF1 protein, GST-tagged | +Inquiry |
MLF1-29154TH | Recombinant Human MLF1, T7 -tagged | +Inquiry |
MLF1-2780R | Recombinant Rhesus monkey MLF1 Protein, His-tagged | +Inquiry |
MLF1-3229H | Recombinant Human MLF1 protein, GST-tagged | +Inquiry |
MLF1-2944H | Recombinant Human Myeloid Leukemia Factor 1, T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MLF1-4297HCL | Recombinant Human MLF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MLF1 Products
Required fields are marked with *
My Review for All MLF1 Products
Required fields are marked with *