Recombinant Human MLF1 protein, T7-tagged

• Cat.No.: MLF1-149H
• Product Overview: Recombinant human MLF1 (268 aa, isoforms-I) fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• Protein Length: 268 a.a.
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGEFMFRMLNSSFEDDPFFSESILAHRENMRQMIRSFSEPFGRDLLSISDGRGRAHNRRGHNDG EDSLTHTDVSSFQTMDQMVSNMRNYMQKLERNFGQLSVDPNGHSFCSSSVMTYSKIGDEPPKVFQASTQTRRAPG GIKETRKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEVNQEFINMNESDAHAFDEEWQSEVLKYKPGR HNLGNTRMRSVGHENPGSRELKRREKPQQSPAIEHGRRSNVLGDKLHIKGSSVKSNKK
• Purity: >90% by SDS-PAGE
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: MLF1 myeloid leukemia factor 1 [ Homo sapiens ]
• Official Symbol: MLF1
• Synonyms: MLF1; myeloid leukemia factor 1; myeloid leukemia factor 1 variant 1; myeloid leukemia factor 1 variant 2; myeloid leukemia factor 1 variant 3; myelodysplasia-myeloid leukemia factor 1
• Gene ID: 4291
• mRNA Refseq: NM_001130156
• Protein Refseq: NP_001123628
• MIM: 601402
• UniProt ID: P58340
• Chromosome Location: 3q25
• Pathway: Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem
• Function: DNA binding; DNA binding; protein binding; protein domain specific binding