"MLF1" Related Products

Expand
Expand

Recombinant Human MLF1 protein, T7-tagged

Cat.No. : MLF1-149H
Product Overview : Recombinant human MLF1 (268 aa, isoforms-I) fused with T7 Tag at N-terminal was expressed in E. coli.
Source : E. coli
Species : Human
Tag : T7
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGEFMFRMLNSSFEDDPFFSESILAHRENMRQMIRSFSEPFGRDLLSISDGRGRAHNRRGHNDG EDSLTHTDVSSFQTMDQMVSNMRNYMQKLERNFGQLSVDPNGHSFCSSSVMTYSKIGDEPPKVFQASTQTRRAPG GIKETRKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEVNQEFINMNESDAHAFDEEWQSEVLKYKPGR HNLGNTRMRSVGHENPGSRELKRREKPQQSPAIEHGRRSNVLGDKLHIKGSSVKSNKK
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name : MLF1 myeloid leukemia factor 1 [ Homo sapiens ]
Official Symbol : MLF1
Synonyms : MLF1; myeloid leukemia factor 1; myeloid leukemia factor 1 variant 1; myeloid leukemia factor 1 variant 2; myeloid leukemia factor 1 variant 3; myelodysplasia-myeloid leukemia factor 1;
Gene ID : 4291
mRNA Refseq : NM_001130156
Protein Refseq : NP_001123628
MIM : 601402
UniProt ID : P58340
Chromosome Location : 3q25
Pathway : Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem;
Function : DNA binding; DNA binding; protein binding; protein domain specific binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.