Recombinant Human MLF1 protein, T7-tagged
Cat.No. : | MLF1-149H |
Product Overview : | Recombinant human MLF1 (268 aa, isoforms-I) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 268 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGEFMFRMLNSSFEDDPFFSESILAHRENMRQMIRSFSEPFGRDLLSISDGRGRAHNRRGHNDG EDSLTHTDVSSFQTMDQMVSNMRNYMQKLERNFGQLSVDPNGHSFCSSSVMTYSKIGDEPPKVFQASTQTRRAPG GIKETRKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEVNQEFINMNESDAHAFDEEWQSEVLKYKPGR HNLGNTRMRSVGHENPGSRELKRREKPQQSPAIEHGRRSNVLGDKLHIKGSSVKSNKK |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | MLF1 myeloid leukemia factor 1 [ Homo sapiens ] |
Official Symbol | MLF1 |
Synonyms | MLF1; myeloid leukemia factor 1; myeloid leukemia factor 1 variant 1; myeloid leukemia factor 1 variant 2; myeloid leukemia factor 1 variant 3; myelodysplasia-myeloid leukemia factor 1; |
Gene ID | 4291 |
mRNA Refseq | NM_001130156 |
Protein Refseq | NP_001123628 |
MIM | 601402 |
UniProt ID | P58340 |
Chromosome Location | 3q25 |
Pathway | Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem; |
Function | DNA binding; DNA binding; protein binding; protein domain specific binding; |
◆ Recombinant Proteins | ||
MLF1-2780R | Recombinant Rhesus monkey MLF1 Protein, His-tagged | +Inquiry |
MLF1-2601R | Recombinant Rhesus Macaque MLF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MLF1-3229H | Recombinant Human MLF1 protein, GST-tagged | +Inquiry |
MLF1-149H | Recombinant Human MLF1 protein, T7-tagged | +Inquiry |
MLF1-29154TH | Recombinant Human MLF1, T7 -tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MLF1-4297HCL | Recombinant Human MLF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MLF1 Products
Required fields are marked with *
My Review for All MLF1 Products
Required fields are marked with *