Recombinant Human MLLT11 protein, T7/His-tagged

Cat.No. : MLLT11-206H
Product Overview : Recombinant human MMLT11 ( 2 - 90 aa, derived from BC022448 ) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 2-90 a.a.
Form : 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGEFRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKM IGQATAADQEKNPEGDGLLEYSTFNFWRAPIASIHSFELDLL
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name MLLT11 myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 11 [ Homo sapiens ]
Official Symbol MLLT11
Synonyms MLLT11; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 11; protein AF1q; AF1Q; ALL1 fused gene from chromosome 1q; ALL1-fused gene from chromosome 1q; RP11-316M1.10;
Gene ID 10962
mRNA Refseq NM_006818
Protein Refseq NP_006809
MIM 604684
UniProt ID Q13015
Chromosome Location 1q21
Function molecular_function;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MLLT11 Products

Required fields are marked with *

My Review for All MLLT11 Products

Required fields are marked with *

0
cart-icon