Recombinant Human MLLT11 protein, T7/His-tagged

• Cat.No.: MLLT11-206H
• Product Overview: Recombinant human MMLT11 ( 2 - 90 aa, derived from BC022448 ) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 2-90 a.a.
• Form: 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGEFRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKM IGQATAADQEKNPEGDGLLEYSTFNFWRAPIASIHSFELDLL
• Purity: >90% by SDS-PAGE
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: MLLT11 myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 11 [ Homo sapiens ]
• Official Symbol: MLLT11
• Synonyms: MLLT11; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 11; protein AF1q; AF1Q; ALL1 fused gene from chromosome 1q; ALL1-fused gene from chromosome 1q; RP11-316M1.10
• Gene ID: 10962
• mRNA Refseq: NM_006818
• Protein Refseq: NP_006809
• MIM: 604684
• UniProt ID: Q13015
• Chromosome Location: 1q21
• Function: molecular_function