Recombinant Human MLN Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MLN-1201H
• Product Overview: MLN MS Standard C13 and N15-labeled recombinant protein (NP_002409) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a small peptide hormone that is secreted by cells of the small intestine to regulate gastrointestinal contractions and motility. Proteolytic processing of the secreted protein produces the mature peptide and a byproduct referred to as motilin-associated peptide (MAP). Three transcript variants encoding different preproprotein isoforms but the same mature peptide have been found for this gene.
• Molecular Mass: 12.9 kDa
• AA Sequence: MVSRKAVAALLVVHAAAMLASQTEAFVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MLN motilin [ Homo sapiens (human) ]
• Official Symbol: MLN
• Synonyms: MLN; motilin; prepromotilin; promotilin; MGC138519
• Gene ID: 4295
• mRNA Refseq: NM_002418
• Protein Refseq: NP_002409
• MIM: 158270
• UniProt ID: P12872