Recombinant Human MLN Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MLN-1201H |
Product Overview : | MLN MS Standard C13 and N15-labeled recombinant protein (NP_002409) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a small peptide hormone that is secreted by cells of the small intestine to regulate gastrointestinal contractions and motility. Proteolytic processing of the secreted protein produces the mature peptide and a byproduct referred to as motilin-associated peptide (MAP). Three transcript variants encoding different preproprotein isoforms but the same mature peptide have been found for this gene. |
Molecular Mass : | 12.9 kDa |
AA Sequence : | MVSRKAVAALLVVHAAAMLASQTEAFVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MLN motilin [ Homo sapiens (human) ] |
Official Symbol | MLN |
Synonyms | MLN; motilin; prepromotilin; promotilin; MGC138519; |
Gene ID | 4295 |
mRNA Refseq | NM_002418 |
Protein Refseq | NP_002409 |
MIM | 158270 |
UniProt ID | P12872 |
◆ Recombinant Proteins | ||
MLN-4556H | Recombinant Human MLN Protein (Phe26-Lys115), C-His tagged | +Inquiry |
MLN-579H | Recombinant Human MLN Protein, MYC/DDK-tagged | +Inquiry |
MLN-2594H | Recombinant Human MLN protein, His & S-tagged | +Inquiry |
MLN-2785R | Recombinant Rhesus monkey MLN Protein, His-tagged | +Inquiry |
MLN-27721TH | Recombinant Human MLN | +Inquiry |
◆ Cell & Tissue Lysates | ||
MLN-4291HCL | Recombinant Human MLN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MLN Products
Required fields are marked with *
My Review for All MLN Products
Required fields are marked with *