Recombinant Human MLN Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | MLN-1201H |
| Product Overview : | MLN MS Standard C13 and N15-labeled recombinant protein (NP_002409) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a small peptide hormone that is secreted by cells of the small intestine to regulate gastrointestinal contractions and motility. Proteolytic processing of the secreted protein produces the mature peptide and a byproduct referred to as motilin-associated peptide (MAP). Three transcript variants encoding different preproprotein isoforms but the same mature peptide have been found for this gene. |
| Molecular Mass : | 12.9 kDa |
| AA Sequence : | MVSRKAVAALLVVHAAAMLASQTEAFVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | MLN motilin [ Homo sapiens (human) ] |
| Official Symbol | MLN |
| Synonyms | MLN; motilin; prepromotilin; promotilin; MGC138519; |
| Gene ID | 4295 |
| mRNA Refseq | NM_002418 |
| Protein Refseq | NP_002409 |
| MIM | 158270 |
| UniProt ID | P12872 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MLN Products
Required fields are marked with *
My Review for All MLN Products
Required fields are marked with *
