Recombinant Human MMAB, His-tagged
Cat.No. : | MMAB-27647TH |
Product Overview : | Recombinant full length Human MMAB with an N terminal His tag; 239 amino acids with tag, Predicted MWt 26.3 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 218 amino acids |
Description : | This gene encodes a protein that catalyzes the final step in the conversion of vitamin B(12) into adenosylcobalamin (Ad°Cbl), a vitamin B12-containing coenzyme for methylmalonyl-CoA mutase. Mutations in the gene are the cause of vitamin B12-dependent methylmalonic aciduria linked to the cblB complementation group. Alternatively spliced transcript variants have been found. |
Conjugation : | HIS |
Molecular Weight : | 26.300kDa inclusive of tags |
Tissue specificity : | Expressed in liver and skeletal muscle. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMQSRGPQGVEDGDRPQPSSKTPRIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYKKNDPSAESEGL |
Sequence Similarities : | Belongs to the Cob(I)alamin adenosyltransferase family. |
Gene Name | MMAB methylmalonic aciduria (cobalamin deficiency) cblB type [ Homo sapiens ] |
Official Symbol | MMAB |
Synonyms | MMAB; methylmalonic aciduria (cobalamin deficiency) cblB type; methylmalonic aciduria (cobalamin deficiency) type B; cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial; ATP:cob(I)alamin adenosyltransferase; cblB; |
Gene ID | 326625 |
mRNA Refseq | NM_052845 |
Protein Refseq | NP_443077 |
MIM | 607568 |
Uniprot ID | Q96EY8 |
Chromosome Location | 12q24 |
Pathway | Metabolic pathways, organism-specific biosystem; Porphyrin and chlorophyll metabolism, organism-specific biosystem; Porphyrin and chlorophyll metabolism, conserved biosystem; |
Function | ATP binding; cob(I)yrinic acid a,c-diamide adenosyltransferase activity; nucleotide binding; transferase activity; |
◆ Recombinant Proteins | ||
MMAB-629H | Recombinant Human MMAB, GST-tagged | +Inquiry |
MMAB-5592M | Recombinant Mouse MMAB Protein, His (Fc)-Avi-tagged | +Inquiry |
MMAB-630H | Recombinant Human MMAB, GST-tagged | +Inquiry |
MMAB-559HF | Recombinant Full Length Human MMAB Protein, GST-tagged | +Inquiry |
MMAB-3185H | Recombinant Human MMAB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMAB-4285HCL | Recombinant Human MMAB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMAB Products
Required fields are marked with *
My Review for All MMAB Products
Required fields are marked with *