Recombinant Human MMD Protein, GST-tagged

Cat.No. : MMD-5406H
Product Overview : Human MMD full-length ORF ( NP_036461.2, 1 a.a. - 238 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This protein is expressed by in vitro differentiated macrophages but not freshly isolated monocytes. Although sequence analysis identifies seven potential transmembrane domains, this protein has little homology to G-protein receptors and it has not been positively identified as a receptor. A suggested alternative function is that of an ion channel protein in maturing macrophages. [provided by RefSeq
Molecular Mass : 54.1 kDa
AA Sequence : MRFKNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLHRLSDDCWEKITAWIYGMGLCALFIVSTVFHIVSWKKSHLRTVEHCFHMCDRMVIYFFIAASYAPWLNLRELGPLASHMRWFIWLMAAGGTIYVFLYHEKYKVVELFFYLTMGFSPALVVTSMNNTDGLQELACGGLIYCLGVVFFKSDGIIPFAHAIWHLFVATAAAVHYYAIWKYLYRSPTDFMRHL
Applications : Antibody Production
Functional Study
Compound Screening
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MMD monocyte to macrophage differentiation-associated [ Homo sapiens ]
Official Symbol MMD
Synonyms MMD; monocyte to macrophage differentiation-associated; monocyte to macrophage differentiation protein; MMA; PAQR11; macrophage maturation-associated; progestin and adipoQ receptor family member 11; progestin and adipoQ receptor family member XI; MMD1;
Gene ID 23531
mRNA Refseq NM_012329
Protein Refseq NP_036461
MIM 604467
UniProt ID Q15546

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MMD Products

Required fields are marked with *

My Review for All MMD Products

Required fields are marked with *

0
cart-icon
0
compare icon