Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human MME

Cat.No. : MME-26365TH
Product Overview : Recombinant fragment corresponding to amino acids 145-249 of Human CD10 with an N terminal proprietary tag; Predicted MWt 37.29 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a common acute lymphocytic leukemia antigen that is an important cell surface marker in the diagnosis of human acute lymphocytic leukemia (ALL). This protein is present on leukemic cells of pre-B phenotype, which represent 85% of cases of ALL. This protein is not restricted to leukemic cells, however, and is found on a variety of normal tissues. It is a glycoprotein that is particularly abundant in kidney, where it is present on the brush border of proximal tubules and on glomerular epithelium. The protein is a neutral endopeptidase that cleaves peptides at the amino side of hydrophobic residues and inactivates several peptide hormones including glucagon, enkephalins, substance P, neurotensin, oxytocin, and bradykinin. This gene, which encodes a 100-kD type II transmembrane glycoprotein, exists in a single copy of greater than 45 kb. The 5 untranslated region of this gene is alternatively spliced, resulting in four separate mRNA transcripts. The coding region is not affected by alternative splicing.
Protein length : 105 amino acids
Molecular Weight : 37.290kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : NESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTA EKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQPRL GLPSRDYYECTGIYKEACTAYVDFM
Sequence Similarities : Belongs to the peptidase M13 family.
Gene Name : MME membrane metallo-endopeptidase [ Homo sapiens ]
Official Symbol : MME
Synonyms : MME; membrane metallo-endopeptidase; neprilysin; CALLA; CD10; enkephalinase; NEP; neutral endopeptidase;
Gene ID : 4311
mRNA Refseq : NM_000902
Protein Refseq : NP_000893
MIM : 120520
Uniprot ID : P08473
Chromosome Location : 3q21-q27
Pathway : Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Protein digestion and absorption, organism-specific biosystem;
Function : metal ion binding; metalloendopeptidase activity; metallopeptidase activity; peptidase activity; peptide binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends