Recombinant Human MMP20 protein, His&Myc-tagged
| Cat.No. : | MMP20-3234H | 
| Product Overview : | Recombinant Human MMP20 protein(O60882)(108-483aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His&Myc | 
| Protein Length : | 108-483aa | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | 
| Molecular Mass : | 47.6 kDa | 
| AA Sequence : | YRLFPGEPKWKKNTLTYRISKYTPSMSSVEVDKAVEMALQAWSSAVPLSFVRINSGEADIMISFENGDHGDSYPFDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTNGFNLFTVAAHEFGHALGLAHSTDPSALMYPTYKYKNPYGFHLPKDDVKGIQALYGPRKVFLGKPTLPHAPHHKPSIPDLCDSSSSFDAVTMLGKELLLFKDRIFWRRQVHLRTGIRPSTITSSFPQLMSNVDAAYEVAERGTAYFFKGPHYWITRGFQMQGPPRTIYDFGFPRHVQQIDAAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDAAVELNGYIYFFSGPKTYKYDTEKEDVVSVVKSSSWIGC | 
| Purity : | Greater than 85% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. | 
| Gene Name | MMP20 matrix metallopeptidase 20 [ Homo sapiens ] | 
| Official Symbol | MMP20 | 
| Synonyms | MMP20; matrix metallopeptidase 20; matrix metalloproteinase 20 (enamelysin); matrix metalloproteinase-20; enamelysin; enamel metalloproteinase; AI2A2; MMP-20; | 
| Gene ID | 9313 | 
| mRNA Refseq | NM_004771 | 
| Protein Refseq | NP_004762 | 
| MIM | 604629 | 
| UniProt ID | O60882 | 
| ◆ Recombinant Proteins | ||
| MMP20-16H | Recombinant Human MMP20 Protein, His&Myc-tagged | +Inquiry | 
| MMP20-5042H | Recombinant Human MMP20 protein, His&Myc-tagged | +Inquiry | 
| MMP20-3234H | Recombinant Human MMP20 protein, His&Myc-tagged | +Inquiry | 
| Mmp20-1881M | Recombinant Mouse Mmp20 protein, His & T7-tagged | +Inquiry | 
| MMP20-162H | Recombinant Human MMP20, Catalytic Domain | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| MMP20-4276HCL | Recombinant Human MMP20 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP20 Products
Required fields are marked with *
My Review for All MMP20 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            