Recombinant Human MMP20 protein, His&Myc-tagged
Cat.No. : | MMP20-3234H |
Product Overview : | Recombinant Human MMP20 protein(O60882)(108-483aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 108-483aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 47.6 kDa |
AA Sequence : | YRLFPGEPKWKKNTLTYRISKYTPSMSSVEVDKAVEMALQAWSSAVPLSFVRINSGEADIMISFENGDHGDSYPFDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTNGFNLFTVAAHEFGHALGLAHSTDPSALMYPTYKYKNPYGFHLPKDDVKGIQALYGPRKVFLGKPTLPHAPHHKPSIPDLCDSSSSFDAVTMLGKELLLFKDRIFWRRQVHLRTGIRPSTITSSFPQLMSNVDAAYEVAERGTAYFFKGPHYWITRGFQMQGPPRTIYDFGFPRHVQQIDAAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDAAVELNGYIYFFSGPKTYKYDTEKEDVVSVVKSSSWIGC |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | MMP20 matrix metallopeptidase 20 [ Homo sapiens ] |
Official Symbol | MMP20 |
Synonyms | MMP20; matrix metallopeptidase 20; matrix metalloproteinase 20 (enamelysin); matrix metalloproteinase-20; enamelysin; enamel metalloproteinase; AI2A2; MMP-20; |
Gene ID | 9313 |
mRNA Refseq | NM_004771 |
Protein Refseq | NP_004762 |
MIM | 604629 |
UniProt ID | O60882 |
◆ Recombinant Proteins | ||
MMP20-2612R | Recombinant Rhesus Macaque MMP20 Protein, His (Fc)-Avi-tagged | +Inquiry |
MMP20-3234H | Recombinant Human MMP20 protein, His&Myc-tagged | +Inquiry |
MMP20-9917M | Recombinant Mouse MMP20 Protein | +Inquiry |
MMP20-162H | Recombinant Human MMP20, Catalytic Domain | +Inquiry |
MMP20-541H | Recombinant Human MMP20 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP20-4276HCL | Recombinant Human MMP20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP20 Products
Required fields are marked with *
My Review for All MMP20 Products
Required fields are marked with *