Recombinant Human MMP20 protein, His&Myc-tagged
| Cat.No. : | MMP20-3234H |
| Product Overview : | Recombinant Human MMP20 protein(O60882)(108-483aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 108-483aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 47.6 kDa |
| AA Sequence : | YRLFPGEPKWKKNTLTYRISKYTPSMSSVEVDKAVEMALQAWSSAVPLSFVRINSGEADIMISFENGDHGDSYPFDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTNGFNLFTVAAHEFGHALGLAHSTDPSALMYPTYKYKNPYGFHLPKDDVKGIQALYGPRKVFLGKPTLPHAPHHKPSIPDLCDSSSSFDAVTMLGKELLLFKDRIFWRRQVHLRTGIRPSTITSSFPQLMSNVDAAYEVAERGTAYFFKGPHYWITRGFQMQGPPRTIYDFGFPRHVQQIDAAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDAAVELNGYIYFFSGPKTYKYDTEKEDVVSVVKSSSWIGC |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | MMP20 matrix metallopeptidase 20 [ Homo sapiens ] |
| Official Symbol | MMP20 |
| Synonyms | MMP20; matrix metallopeptidase 20; matrix metalloproteinase 20 (enamelysin); matrix metalloproteinase-20; enamelysin; enamel metalloproteinase; AI2A2; MMP-20; |
| Gene ID | 9313 |
| mRNA Refseq | NM_004771 |
| Protein Refseq | NP_004762 |
| MIM | 604629 |
| UniProt ID | O60882 |
| ◆ Recombinant Proteins | ||
| MMP20-3234H | Recombinant Human MMP20 protein, His&Myc-tagged | +Inquiry |
| MMP20-9917M | Recombinant Mouse MMP20 Protein | +Inquiry |
| MMP20-162H | Active Recombinant Human MMP20 protein, Catalytic Domain No Activation Required | +Inquiry |
| MMP20-2612R | Recombinant Rhesus Macaque MMP20 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MMP20-2791R | Recombinant Rhesus monkey MMP20 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MMP20-4276HCL | Recombinant Human MMP20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP20 Products
Required fields are marked with *
My Review for All MMP20 Products
Required fields are marked with *
