Recombinant Human MN1
| Cat.No. : | MN1-28419TH |
| Product Overview : | Recombinant fragment of Human MN1 with an N terminal proprietary tag; Predicted MWt 37.62 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 109 amino acids |
| Description : | Meningioma 1 (MN1) contains two sets of CAG repeats. It is disrupted by a balanced translocation (4;22) in a meningioma, and its inactivation may contribute to meningioma 32 pathogenesis. |
| Molecular Weight : | 37.620kDa inclusive of tags |
| Tissue specificity : | Ubiquitously expressed. Highest levels in skeletal muscle. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | STIDLDSLMAEHSAAWYMPADKALVDSADDDKTLAPWEKA KPQNPNSKEAHDLPANKASASQPGSHLQCLSVHCTDDVGD AKARASVPTWRSLHSDISNRFGTFVAALT |
| Gene Name | MN1 meningioma (disrupted in balanced translocation) 1 [ Homo sapiens ] |
| Official Symbol | MN1 |
| Synonyms | MN1; meningioma (disrupted in balanced translocation) 1; meningioma chromosome region , MGCR; probable tumor suppressor protein MN1; MGCR1; MGCR1 PEN; |
| Gene ID | 4330 |
| mRNA Refseq | NM_002430 |
| Protein Refseq | NP_002421 |
| MIM | 156100 |
| Uniprot ID | Q10571 |
| Chromosome Location | 22q12.1 |
| Function | binding; molecular_function; |
| ◆ Recombinant Proteins | ||
| MN1-5442H | Recombinant Human MN1 Protein, GST-tagged | +Inquiry |
| MN1-28419TH | Recombinant Human MN1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MN1 Products
Required fields are marked with *
My Review for All MN1 Products
Required fields are marked with *
Recently Viewed
