Recombinant Human MOB1A
| Cat.No. : | MOB1A-28178TH |
| Product Overview : | Recombinant full length Human MOBK1B expressed in Saccharomyces cerevisiae; amino acids 1-216, 216 amino acids, MWt 25.1 kDa. Protein is tagged with 26 kDa proprietary tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Tag : | Non |
| Protein Length : | 1-216 a.a. |
| Tissue specificity : | Adrenal gland, bone marrow, brain, placenta, prostate, salivary gland, skeletal muscle, testis, thymus, thyroid gland, heart, spinal cord, fetal brain and fetal liver. |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGN LRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEF CTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYID YLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLF RVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFN LIDRRELAPLQELIEKLGSKDR |
| Sequence Similarities : | Belongs to the MOB1/phocein family. |
| Full Length : | Full L. |
| Gene Name | MOB1A MOB kinase activator 1A [ Homo sapiens ] |
| Official Symbol | MOB1A |
| Synonyms | MOB1A; MOB kinase activator 1A; C2orf6, chromosome 2 open reading frame 6 , MOB1 Mps One Binder homolog A (yeast) , MOB1, Mps One Binder kinase activator like 1B (yeast) , MOBK1B, MOBKL1B; mps one binder kinase activator-like 1B; FLJ10788; FLJ11595; Ma |
| Gene ID | 55233 |
| mRNA Refseq | NM_018221 |
| Protein Refseq | NP_060691 |
| MIM | 609281 |
| Uniprot ID | Q9H8S9 |
| Chromosome Location | 2p13.1 |
| Function | metal ion binding; protein binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOB1A Products
Required fields are marked with *
My Review for All MOB1A Products
Required fields are marked with *
