Recombinant Human MOB1A, His-tagged
Cat.No. : | MOB1A-28177TH |
Product Overview : | Recombinant full length Human MOBK1B with an N terminal His tag; 236 amino acids with tag, Predicted MWt 27.2 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 216 amino acids |
Conjugation : | HIS |
Molecular Weight : | 27.200kDa inclusive of tags |
Tissue specificity : | Adrenal gland, bone marrow, brain, placenta, prostate, salivary gland, skeletal muscle, testis, thymus, thyroid gland, heart, spinal cord, fetal brain and fetal liver. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR |
Sequence Similarities : | Belongs to the MOB1/phocein family. |
Gene Name | MOB1A MOB kinase activator 1A [ Homo sapiens ] |
Official Symbol | MOB1A |
Synonyms | MOB1A; MOB kinase activator 1A; C2orf6, chromosome 2 open reading frame 6 , MOB1 Mps One Binder homolog A (yeast) , MOB1, Mps One Binder kinase activator like 1B (yeast) , MOBK1B, MOBKL1B; mps one binder kinase activator-like 1B; FLJ10788; FLJ11595; Ma |
Gene ID | 55233 |
mRNA Refseq | NM_018221 |
Protein Refseq | NP_060691 |
MIM | 609281 |
Uniprot ID | Q9H8S9 |
Chromosome Location | 2p13.1 |
Function | metal ion binding; protein binding; |
◆ Recombinant Proteins | ||
MOB1A-5455H | Recombinant Human MOB1A Protein, GST-tagged | +Inquiry |
MOB1A-28177TH | Recombinant Human MOB1A, His-tagged | +Inquiry |
Mob1a-4104M | Recombinant Mouse Mob1a Protein, Myc/DDK-tagged | +Inquiry |
MOB1A-6292HF | Recombinant Full Length Human MOB1A Protein, GST-tagged | +Inquiry |
MOB1A-3381R | Recombinant Rat MOB1A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MOB1A-413HCL | Recombinant Human MOB1A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOB1A Products
Required fields are marked with *
My Review for All MOB1A Products
Required fields are marked with *