Recombinant Human MOB1A, His-tagged
| Cat.No. : | MOB1A-28177TH |
| Product Overview : | Recombinant full length Human MOBK1B with an N terminal His tag; 236 amino acids with tag, Predicted MWt 27.2 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 216 amino acids |
| Conjugation : | HIS |
| Molecular Weight : | 27.200kDa inclusive of tags |
| Tissue specificity : | Adrenal gland, bone marrow, brain, placenta, prostate, salivary gland, skeletal muscle, testis, thymus, thyroid gland, heart, spinal cord, fetal brain and fetal liver. |
| Form : | Liquid |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0 |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR |
| Sequence Similarities : | Belongs to the MOB1/phocein family. |
| Gene Name | MOB1A MOB kinase activator 1A [ Homo sapiens ] |
| Official Symbol | MOB1A |
| Synonyms | MOB1A; MOB kinase activator 1A; C2orf6, chromosome 2 open reading frame 6 , MOB1 Mps One Binder homolog A (yeast) , MOB1, Mps One Binder kinase activator like 1B (yeast) , MOBK1B, MOBKL1B; mps one binder kinase activator-like 1B; FLJ10788; FLJ11595; Ma |
| Gene ID | 55233 |
| mRNA Refseq | NM_018221 |
| Protein Refseq | NP_060691 |
| MIM | 609281 |
| Uniprot ID | Q9H8S9 |
| Chromosome Location | 2p13.1 |
| Function | metal ion binding; protein binding; |
| ◆ Recombinant Proteins | ||
| MOB1A-5617M | Recombinant Mouse MOB1A Protein, His (Fc)-Avi-tagged | +Inquiry |
| MOB1A-9940M | Recombinant Mouse MOB1A Protein | +Inquiry |
| MOB1A-4834H | Recombinant Human MOB1A protein, His-SUMO-tagged | +Inquiry |
| MOB1A-6292HF | Recombinant Full Length Human MOB1A Protein, GST-tagged | +Inquiry |
| MOB1A-10283Z | Recombinant Zebrafish MOB1A | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MOB1A-413HCL | Recombinant Human MOB1A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOB1A Products
Required fields are marked with *
My Review for All MOB1A Products
Required fields are marked with *
