Recombinant Human MORC1 Protein, GST-tagged

Cat.No. : MORC1-5475H
Product Overview : Human MORC1 partial ORF ( NP_055244, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes the human homolog of mouse morc and like the mouse protein it is testis-specific. Mouse studies support a testis-specific function since only male knockout mice are infertile; infertility is the only apparent defect. These studies further support a role for this protein early in spermatogenesis, possibly by affecting entry into apoptosis because testis from knockout mice show greatly increased numbers of apoptotic cells. [provided by RefSeq
Molecular Mass : 36.74 kDa
AA Sequence : MDDRYPALQRAQLRLDFIHANSTTHSFLFGALAELLDNARDAGAERLDVFSVDNEKLQGGFMLCFLDDGCGMSPEEASDIIYFGRSKKRLSTLKFIGQYG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MORC1 MORC family CW-type zinc finger 1 [ Homo sapiens ]
Official Symbol MORC1
Synonyms MORC1; MORC family CW-type zinc finger 1; microrchidia (mouse) homolog , microrchidia homolog (mouse) , MORC; MORC family CW-type zinc finger protein 1; cancer/testis antigen 33; CT33; ZCW6; microrchidia, mouse, homolog of; MORC;
Gene ID 27136
mRNA Refseq NM_014429
Protein Refseq NP_055244
MIM 603205
UniProt ID Q86VD1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MORC1 Products

Required fields are marked with *

My Review for All MORC1 Products

Required fields are marked with *

0
cart-icon