Recombinant Human MORC1 Protein, GST-tagged
| Cat.No. : | MORC1-5475H |
| Product Overview : | Human MORC1 partial ORF ( NP_055244, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes the human homolog of mouse morc and like the mouse protein it is testis-specific. Mouse studies support a testis-specific function since only male knockout mice are infertile; infertility is the only apparent defect. These studies further support a role for this protein early in spermatogenesis, possibly by affecting entry into apoptosis because testis from knockout mice show greatly increased numbers of apoptotic cells. [provided by RefSeq |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | MDDRYPALQRAQLRLDFIHANSTTHSFLFGALAELLDNARDAGAERLDVFSVDNEKLQGGFMLCFLDDGCGMSPEEASDIIYFGRSKKRLSTLKFIGQYG |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MORC1 MORC family CW-type zinc finger 1 [ Homo sapiens ] |
| Official Symbol | MORC1 |
| Synonyms | MORC1; MORC family CW-type zinc finger 1; microrchidia (mouse) homolog , microrchidia homolog (mouse) , MORC; MORC family CW-type zinc finger protein 1; cancer/testis antigen 33; CT33; ZCW6; microrchidia, mouse, homolog of; MORC; |
| Gene ID | 27136 |
| mRNA Refseq | NM_014429 |
| Protein Refseq | NP_055244 |
| MIM | 603205 |
| UniProt ID | Q86VD1 |
| ◆ Recombinant Proteins | ||
| MORC1-5475H | Recombinant Human MORC1 Protein, GST-tagged | +Inquiry |
| MORC1-9958M | Recombinant Mouse MORC1 Protein | +Inquiry |
| MORC1-5631M | Recombinant Mouse MORC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MORC1 Products
Required fields are marked with *
My Review for All MORC1 Products
Required fields are marked with *
