Recombinant Human MORF4L2 Protein, GST-tagged
Cat.No. : | MORF4L2-5479H |
Product Overview : | Human MORF4L2 full-length ORF ( NP_036418.1, 1 a.a. - 288 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MORF4L2 (Mortality Factor 4 Like 2) is a Protein Coding gene. Diseases associated with MORF4L2 include Paraneoplastic Cerebellar Degeneration. Among its related pathways are Chromatin organization. An important paralog of this gene is MORF4L1. |
Molecular Mass : | 58.7 kDa |
AA Sequence : | MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASAEYHRKAL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MORF4L2 mortality factor 4 like 2 [ Homo sapiens ] |
Official Symbol | MORF4L2 |
Synonyms | MORF4L2; mortality factor 4 like 2; mortality factor 4-like protein 2; KIAA0026; MORF related gene X; MRGX; MSL3-2 protein; protein MSL3-2; MORF-related gene X protein; transcription factor-like protein MRGX; MORFL2; |
Gene ID | 9643 |
mRNA Refseq | NM_001142418 |
Protein Refseq | NP_001135890 |
MIM | 300409 |
UniProt ID | Q15014 |
◆ Recombinant Proteins | ||
MORF4L2-5747H | Recombinant Human MORF4L2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MORF4L2-5479H | Recombinant Human MORF4L2 Protein, GST-tagged | +Inquiry |
MORF4L2-9964M | Recombinant Mouse MORF4L2 Protein | +Inquiry |
MORF4L2-446C | Recombinant Cynomolgus Monkey MORF4L2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MORF4L2-1399H | Recombinant Human MORF4L2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
MORF4L2-4251HCL | Recombinant Human MORF4L2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MORF4L2 Products
Required fields are marked with *
My Review for All MORF4L2 Products
Required fields are marked with *
0
Inquiry Basket