Recombinant Human MOSPD1 Protein, GST-tagged

Cat.No. : MOSPD1-5487H
Product Overview : Human MOSPD1 full-length ORF ( NP_062456.1, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MOSPD1 (Motile Sperm Domain Containing 1) is a Protein Coding gene. Diseases associated with MOSPD1 include Conotruncal Heart Malformations. GO annotations related to this gene include structural molecule activity. An important paralog of this gene is MOSPD3.
Molecular Mass : 50.5 kDa
AA Sequence : MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKYVVVDAAGAVKPQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQRKALGRKEVVATLLPSAKEQQKEEEEKRLKEHLTESLFFEQSFQPENRAVSSGPSLLTVFLGVVCIAALMLPTLGDVESLVPLYLHLSVNQKLVAAYILGLITMAILRT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MOSPD1 motile sperm domain containing 1 [ Homo sapiens ]
Official Symbol MOSPD1
Synonyms DJ473B4; MOSPD1; motile sperm domain containing 1
Gene ID 56180
mRNA Refseq NM_019556
Protein Refseq NP_062456
MIM 300674
UniProt ID Q9UJG1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MOSPD1 Products

Required fields are marked with *

My Review for All MOSPD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon