Recombinant Human MOSPD1 Protein, GST-tagged
| Cat.No. : | MOSPD1-5487H |
| Product Overview : | Human MOSPD1 full-length ORF ( NP_062456.1, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | MOSPD1 (Motile Sperm Domain Containing 1) is a Protein Coding gene. Diseases associated with MOSPD1 include Conotruncal Heart Malformations. GO annotations related to this gene include structural molecule activity. An important paralog of this gene is MOSPD3. |
| Molecular Mass : | 50.5 kDa |
| AA Sequence : | MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKYVVVDAAGAVKPQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQRKALGRKEVVATLLPSAKEQQKEEEEKRLKEHLTESLFFEQSFQPENRAVSSGPSLLTVFLGVVCIAALMLPTLGDVESLVPLYLHLSVNQKLVAAYILGLITMAILRT |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MOSPD1 motile sperm domain containing 1 [ Homo sapiens ] |
| Official Symbol | MOSPD1 |
| Synonyms | DJ473B4; MOSPD1; motile sperm domain containing 1 |
| Gene ID | 56180 |
| mRNA Refseq | NM_019556 |
| Protein Refseq | NP_062456 |
| MIM | 300674 |
| UniProt ID | Q9UJG1 |
| ◆ Recombinant Proteins | ||
| MOSPD1-2808R | Recombinant Rhesus monkey MOSPD1 Protein, His-tagged | +Inquiry |
| MOSPD1-5640M | Recombinant Mouse MOSPD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MOSPD1-3730R | Recombinant Rat MOSPD1 Protein | +Inquiry |
| MOSPD1-3388R | Recombinant Rat MOSPD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL3443PF | Recombinant Full Length Pongo Abelii Motile Sperm Domain-Containing Protein 1(Mospd1) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MOSPD1-4244HCL | Recombinant Human MOSPD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOSPD1 Products
Required fields are marked with *
My Review for All MOSPD1 Products
Required fields are marked with *




