Recombinant Human MOXD1 protein, GST-tagged

Cat.No. : MOXD1-98H
Product Overview : Recombinant MOXD1 protein(21a.a.-120a.a.), fused to GST-tag at N-terminus, was expressed in Wheat Germ and purified by using Glutathione Sepharose 4 Fast Flow.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 100
Description : DBH-like 1 maintains many of the structural features of dopamine beta-monooxygenase DBH. Since Peptidylglycine alpha-hydroxylating monooxygenase is homologous to dopamine beta-monooxygenase this concerns a structural basis for a new family of copper type II, significantly specific for ascorbate-dependent monooxygenases based on the corresponding mouse homolog. The pathway of catecholamine synthesis is a possible catecholamine-binding metabolic copper enzyme domain, a neuron-like property encoding MOX without a signal sequence enzyme metabolism resolving the monooxygenase X chemical pathway of an unknown substrate, exogenous MOX is not secreted, and it localizes throughout the endoplasmic reticulum, in both endocrine or nonendocrine cells.
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : DYFTNANRELKKDAQQDYHLEYAMENSTHTIIEFTRELHTCDINDKSITDSTVRVIWAYHHEDAGEAGPKYHDSNRGTKSLRLLNPEKTSVLSTALPYFD
Applications : AP, Array, ELISA, WB-Re
Storage : Store at -80 centigrade. Aliquot to avoidrepeated freezing and thawing.
Gene Name MOXD1
Official Symbol MOXD1
Synonyms DKFZp564G202; MOX; PRO5780; dJ248E1.1
Gene ID 26002
mRNA Refseq NM_015529.4
Protein Refseq NP_056344.2
MIM 609000
UniProt ID Q6UVY6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MOXD1 Products

Required fields are marked with *

My Review for All MOXD1 Products

Required fields are marked with *

0
cart-icon
0
compare icon