| Species : |
Human |
| Source : |
Wheat Germ |
| Tag : |
GST |
| Protein Length : |
100 |
| Description : |
DBH-like 1 maintains many of the structural features of dopamine beta-monooxygenase DBH. Since Peptidylglycine alpha-hydroxylating monooxygenase is homologous to dopamine beta-monooxygenase this concerns a structural basis for a new family of copper type II, significantly specific for ascorbate-dependent monooxygenases based on the corresponding mouse homolog. The pathway of catecholamine synthesis is a possible catecholamine-binding metabolic copper enzyme domain, a neuron-like property encoding MOX without a signal sequence enzyme metabolism resolving the monooxygenase X chemical pathway of an unknown substrate, exogenous MOX is not secreted, and it localizes throughout the endoplasmic reticulum, in both endocrine or nonendocrine cells. |
| Form : |
50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : |
36.74 kDa |
| AA Sequence : |
DYFTNANRELKKDAQQDYHLEYAMENSTHTIIEFTRELHTCDINDKSITDSTVRVIWAYHHEDAGEAGPKYHDSNRGTKSLRLLNPEKTSVLSTALPYFD |
| Applications : |
AP, Array, ELISA, WB-Re |
| Storage : |
Store at -80 centigrade. Aliquot to avoidrepeated freezing and thawing. |
