Recombinant Human MOXD1 protein, GST-tagged
Cat.No. : | MOXD1-98H |
Product Overview : | Recombinant MOXD1 protein(21a.a.-120a.a.), fused to GST-tag at N-terminus, was expressed in Wheat Germ and purified by using Glutathione Sepharose 4 Fast Flow. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 100 |
Description : | DBH-like 1 maintains many of the structural features of dopamine beta-monooxygenase DBH. Since Peptidylglycine alpha-hydroxylating monooxygenase is homologous to dopamine beta-monooxygenase this concerns a structural basis for a new family of copper type II, significantly specific for ascorbate-dependent monooxygenases based on the corresponding mouse homolog. The pathway of catecholamine synthesis is a possible catecholamine-binding metabolic copper enzyme domain, a neuron-like property encoding MOX without a signal sequence enzyme metabolism resolving the monooxygenase X chemical pathway of an unknown substrate, exogenous MOX is not secreted, and it localizes throughout the endoplasmic reticulum, in both endocrine or nonendocrine cells. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | DYFTNANRELKKDAQQDYHLEYAMENSTHTIIEFTRELHTCDINDKSITDSTVRVIWAYHHEDAGEAGPKYHDSNRGTKSLRLLNPEKTSVLSTALPYFD |
Applications : | AP, Array, ELISA, WB-Re |
Storage : | Store at -80 centigrade. Aliquot to avoidrepeated freezing and thawing. |
Gene Name | MOXD1 |
Official Symbol | MOXD1 |
Synonyms | DKFZp564G202; MOX; PRO5780; dJ248E1.1 |
Gene ID | 26002 |
mRNA Refseq | NM_015529.4 |
Protein Refseq | NP_056344.2 |
MIM | 609000 |
UniProt ID | Q6UVY6 |
◆ Recombinant Proteins | ||
MOXD1-5641M | Recombinant Mouse MOXD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MOXD1-6318HF | Recombinant Full Length Human MOXD1 Protein, GST-tagged | +Inquiry |
MOXD1-6192C | Recombinant Chicken MOXD1 | +Inquiry |
RFL28898GF | Recombinant Full Length Chicken Dbh-Like Monooxygenase Protein 1(Moxd1) Protein, His-Tagged | +Inquiry |
MOXD1-98H | Recombinant Human MOXD1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MOXD1-1130HCL | Recombinant Human MOXD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOXD1 Products
Required fields are marked with *
My Review for All MOXD1 Products
Required fields are marked with *
0
Inquiry Basket