Recombinant Human MPHOSPH8 Protein, GST-tagged

Cat.No. : MPHOSPH8-5098H
Product Overview : Human HSMPP8 partial ORF ( NP_059990.2, 442 a.a. - 549 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MPHOSPH8 (M-Phase Phosphoprotein 8) is a Protein Coding gene. GO annotations related to this gene include methylated histone binding.
Molecular Mass : 37.62 kDa
AA Sequence : KEIRNAFDLFKLTPEEKNDVSENNRKREEIPLDFKTIDDHKTKENKQSLKERRNTRDETDTWAYIAAEGDQEVLDSVCQADENSDGRQQILSLGMDLQLEWMKLEDFQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MPHOSPH8 M-phase phosphoprotein 8 [ Homo sapiens (human) ]
Official Symbol MPHOSPH8
Synonyms MPHOSPH8; M-phase phosphoprotein 8; TWA3; mpp8; HSMPP8; M-phase phosphoprotein 8; M-phase phosphoprotein, mpp; M-phase phosphoprotein, mpp8; two hybrid-associated protein 3 with RanBPM; EC 2.4.2.30
Gene ID 54737
mRNA Refseq NM_017520
Protein Refseq NP_059990
MIM 611626
UniProt ID Q99549

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MPHOSPH8 Products

Required fields are marked with *

My Review for All MPHOSPH8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon