Recombinant Human MPHOSPH8 Protein, GST-tagged
Cat.No. : | MPHOSPH8-5098H |
Product Overview : | Human HSMPP8 partial ORF ( NP_059990.2, 442 a.a. - 549 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MPHOSPH8 (M-Phase Phosphoprotein 8) is a Protein Coding gene. GO annotations related to this gene include methylated histone binding. |
Molecular Mass : | 37.62 kDa |
AA Sequence : | KEIRNAFDLFKLTPEEKNDVSENNRKREEIPLDFKTIDDHKTKENKQSLKERRNTRDETDTWAYIAAEGDQEVLDSVCQADENSDGRQQILSLGMDLQLEWMKLEDFQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MPHOSPH8 M-phase phosphoprotein 8 [ Homo sapiens (human) ] |
Official Symbol | MPHOSPH8 |
Synonyms | MPHOSPH8; M-phase phosphoprotein 8; TWA3; mpp8; HSMPP8; M-phase phosphoprotein 8; M-phase phosphoprotein, mpp; M-phase phosphoprotein, mpp8; two hybrid-associated protein 3 with RanBPM; EC 2.4.2.30 |
Gene ID | 54737 |
mRNA Refseq | NM_017520 |
Protein Refseq | NP_059990 |
MIM | 611626 |
UniProt ID | Q99549 |
◆ Recombinant Proteins | ||
MPHOSPH8-9985M | Recombinant Mouse MPHOSPH8 Protein | +Inquiry |
MPHOSPH8-6736Z | Recombinant Zebrafish MPHOSPH8 | +Inquiry |
MPHOSPH8-5649M | Recombinant Mouse MPHOSPH8 Protein, His (Fc)-Avi-tagged | +Inquiry |
MPHOSPH8-4050C | Recombinant Chicken MPHOSPH8 | +Inquiry |
MPHOSPH8-3735R | Recombinant Rat MPHOSPH8 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPHOSPH8-4237HCL | Recombinant Human MPHOSPH8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPHOSPH8 Products
Required fields are marked with *
My Review for All MPHOSPH8 Products
Required fields are marked with *
0
Inquiry Basket