Recombinant Human MPI protein, GST-tagged
Cat.No. : | MPI-301556H |
Product Overview : | Recombinant Human MPI (1-423 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Leu423 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MAAPRVFPLSCAVQQYAWGKMGSNSEVARLLASSDPLAQIAEDKPYAELWMGTHPRGDAKILDNRISQKTLSQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEKLHLQAPQHYPDANHKPEMAIALTPFQGLCGFRPVEEIVTFLKKVPEFQFLIGDEAATHLKQTMSHDSQAVASSLQSCFSHLMKSEKKVVVEQLNLLVKRISQQAAAGNNMEDIFGELLLQLHQQYPGDIGCFAIYFLNLLTLKPGEAMFLEANVPHAYLKGDCVECMACSDNTVRAGLTPKFIDVPTLCEMLSYTPSSSKDRLFLPTRSQEDPYLSIYDPPVPDFTIMKTEVPGSVTEYKVLALDSASILLMVQGTVIASTPTTQTPIPLQRGGVLFIGANESVSLKLTEPKDLLIFRACCLL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | MPI mannose phosphate isomerase [ Homo sapiens ] |
Official Symbol | MPI |
Synonyms | MPI; mannose phosphate isomerase; mannose-6-phosphate isomerase; mannose 6 phosphate isomerase; phosphohexomutase; phosphomannose isomerase 1; mannose-6- phosphate isomerase; PMI; PMI1; CDG1B; FLJ39201; |
Gene ID | 4351 |
mRNA Refseq | NM_002435 |
Protein Refseq | NP_002426 |
MIM | 154550 |
UniProt ID | P34949 |
◆ Recombinant Proteins | ||
MPI-3736R | Recombinant Rat MPI Protein | +Inquiry |
MPI-1019H | Recombinant Human MPI, His-tagged | +Inquiry |
MPI-162H | Recombinant Human MPI Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
MPI-3394R | Recombinant Rat MPI Protein, His (Fc)-Avi-tagged | +Inquiry |
Mpi-454M | Recombinant Mouse Mpi Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPI-4235HCL | Recombinant Human MPI 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPI Products
Required fields are marked with *
My Review for All MPI Products
Required fields are marked with *
0
Inquiry Basket