Recombinant Human MPPED2 Protein, GST-tagged

Cat.No. : MPPED2-5519H
Product Overview : Human MPPED2 full-length ORF ( AAH31582, 1 a.a. - 294 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene likely encodes a metallophosphoesterase. The encoded protein may play a role a brain development. Alternatively spliced transcript variants have been described. [provided by RefSeq
Molecular Mass : 58.08 kDa
AA Sequence : MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MPPED2 metallophosphoesterase domain containing 2 [ Homo sapiens ]
Official Symbol MPPED2
Synonyms MPPED2; metallophosphoesterase domain containing 2; C11orf8, chromosome 11 open reading frame 8; metallophosphoesterase MPPED2; 239FB; D11S302E; dJ873F21.1; dJ1024C24.1; FAM1B; Hs.46638; fetal brain protein 239; metallophosphoesterase domain-containing protein 2; C11orf8;
Gene ID 744
mRNA Refseq NM_001145399
Protein Refseq NP_001138871
MIM 600911
UniProt ID Q15777

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MPPED2 Products

Required fields are marked with *

My Review for All MPPED2 Products

Required fields are marked with *

0
cart-icon
0
compare icon