Recombinant Human MPST
Cat.No. : | MPST-30249TH |
Product Overview : | Recombinant fragment corresponding to amino acids 1-100 of Human MPST with an N terminal proprietary tag, 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This protein encoded by this gene catalyzes the transfer of a sulfur ion from 3-mercaptopyruvate to cyanide or other thiol compounds. It may be involved in cysteine degradation and cyanide detoxification. There is confusion in literature between this protein (mercaptopyruvate sulfurtransferase, MPST), which appears to be cytoplasmic, and thiosulfate sulfurtransferase (rhodanese, TST, GeneID:7263), which is a mitochondrial protein. Deficiency in MPST activity has been implicated in a rare inheritable disorder known as mercaptolactate-cysteine disulfiduria (MCDU). Alternatively spliced transcript variants encoding same or different isoforms have been identified for this gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFFDIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIY |
Sequence Similarities : | Contains 2 rhodanese domains. |
Gene ID | MPST mercaptopyruvate sulfurtransferase [ Homo sapiens ] |
Official Symbol | MPST |
Synonyms | MPST; mercaptopyruvate sulfurtransferase; 3-mercaptopyruvate sulfurtransferase; human liver rhodanese; MST; TST2; |
◆ Recombinant Proteins | ||
MPST-3211H | Recombinant Human MPST Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MPST-2637R | Recombinant Rhesus Macaque MPST Protein, His (Fc)-Avi-tagged | +Inquiry |
MPST-7078H | Recombinant Human MPST, His-tagged | +Inquiry |
MPST-29702TH | Recombinant Human MPST | +Inquiry |
MPST-5520H | Recombinant Human MPST Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPST-4224HCL | Recombinant Human MPST 293 Cell Lysate | +Inquiry |
MPST-4223HCL | Recombinant Human MPST 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MPST Products
Required fields are marked with *
My Review for All MPST Products
Required fields are marked with *
0
Inquiry Basket