Recombinant Human MPST

Cat.No. : MPST-30249TH
Product Overview : Recombinant fragment corresponding to amino acids 1-100 of Human MPST with an N terminal proprietary tag, 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This protein encoded by this gene catalyzes the transfer of a sulfur ion from 3-mercaptopyruvate to cyanide or other thiol compounds. It may be involved in cysteine degradation and cyanide detoxification. There is confusion in literature between this protein (mercaptopyruvate sulfurtransferase, MPST), which appears to be cytoplasmic, and thiosulfate sulfurtransferase (rhodanese, TST, GeneID:7263), which is a mitochondrial protein. Deficiency in MPST activity has been implicated in a rare inheritable disorder known as mercaptolactate-cysteine disulfiduria (MCDU). Alternatively spliced transcript variants encoding same or different isoforms have been identified for this gene.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFFDIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIY
Sequence Similarities : Contains 2 rhodanese domains.
Gene ID MPST mercaptopyruvate sulfurtransferase [ Homo sapiens ]
Official Symbol MPST
Synonyms MPST; mercaptopyruvate sulfurtransferase; 3-mercaptopyruvate sulfurtransferase; human liver rhodanese; MST; TST2;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MPST Products

Required fields are marked with *

My Review for All MPST Products

Required fields are marked with *

0
cart-icon