Recombinant Human MPST Protein, GST-tagged
| Cat.No. : | MPST-5520H |
| Product Overview : | Human MPST full-length ORF ( NP_066949.1, 1 a.a. - 297 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This protein encoded by this gene catalyzes the transfer of a sulfur ion from 3-mercaptopyruvate to cyanide or other thiol compounds. It may be involved in cysteine degradation and cyanide detoxification. There is confusion in literature between this protein (mercaptopyruvate sulfurtransferase, MPST), which appears to be cytoplasmic, and thiosulfate sulfurtransferase (rhodanese, TST, GeneID:7263), which is a mitochondrial protein. Deficiency in MPST activity has been implicated in a rare inheritable disorder known as mercaptolactate-cysteine disulfiduria (MCDU). Alternatively spliced transcript variants encoding same or different isoforms have been identified for this gene. [provided by RefSeq |
| Molecular Mass : | 59.6 kDa |
| AA Sequence : | MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFFDIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIYDASDQGLYSAPRVWWMFRAFGHHAVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSWVEWYMRARPEDVISEGRGKTH |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MPST mercaptopyruvate sulfurtransferase [ Homo sapiens ] |
| Official Symbol | MPST |
| Synonyms | MPST; mercaptopyruvate sulfurtransferase; 3-mercaptopyruvate sulfurtransferase; human liver rhodanese; MST; TST2; MGC24539; |
| Gene ID | 4357 |
| mRNA Refseq | NM_001013436 |
| Protein Refseq | NP_001013454 |
| MIM | 602496 |
| UniProt ID | P25325 |
| ◆ Recombinant Proteins | ||
| MPST-4598H | Recombinant Human MPST Protein (Met1-Ala156), N-His tagged | +Inquiry |
| MPST-4791C | Recombinant Chicken MPST | +Inquiry |
| MPST-2637R | Recombinant Rhesus Macaque MPST Protein, His (Fc)-Avi-tagged | +Inquiry |
| Mpst-4129M | Recombinant Mouse Mpst Protein, Myc/DDK-tagged | +Inquiry |
| MPST-536H | Recombinant Human MPST Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MPST-4224HCL | Recombinant Human MPST 293 Cell Lysate | +Inquiry |
| MPST-4223HCL | Recombinant Human MPST 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPST Products
Required fields are marked with *
My Review for All MPST Products
Required fields are marked with *
