| Species : |
Human |
| Source : |
Wheat Germ |
| Tag : |
Non |
| Protein Length : |
176 amino acids |
| Description : |
This gene encodes a mitochondrial inner membrane protein that is implicated in the metabolism of reactive oxygen species. Mutations in this gene have been associated with the hepatocerebral form of mitochondrial DNA depletion syndrome (MDDS). |
| Molecular Weight : |
45.430kDa inclusive of tags |
| Tissue specificity : |
Ubiquitous. Expressed in pancreas, kidney, muscle, liver, lung, placenta, brain and heart. |
| Form : |
Liquid |
| Purity : |
Proprietary Purification |
| Storage buffer : |
pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : |
Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : |
MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVER RGLQEHQRGRTLTMVSLGCGFVGPVVGGWYKVLDRFIPGT TKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNW AKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQC VAVIWNSYLSWKAHRL |
| Sequence Similarities : |
Belongs to the peroxisomal membrane protein PXMP2/4 family. |