Recombinant Human MPV17
| Cat.No. : | MPV17-28635TH |
| Product Overview : | Recombinant full length Human MPV17 with N terminal proprietary tag; Predicted MWt 45.43 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 176 amino acids |
| Description : | This gene encodes a mitochondrial inner membrane protein that is implicated in the metabolism of reactive oxygen species. Mutations in this gene have been associated with the hepatocerebral form of mitochondrial DNA depletion syndrome (MDDS). |
| Molecular Weight : | 45.430kDa inclusive of tags |
| Tissue specificity : | Ubiquitous. Expressed in pancreas, kidney, muscle, liver, lung, placenta, brain and heart. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVER RGLQEHQRGRTLTMVSLGCGFVGPVVGGWYKVLDRFIPGT TKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNW AKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQC VAVIWNSYLSWKAHRL |
| Sequence Similarities : | Belongs to the peroxisomal membrane protein PXMP2/4 family. |
| Gene Name | MPV17 MpV17 mitochondrial inner membrane protein [ Homo sapiens ] |
| Official Symbol | MPV17 |
| Synonyms | MPV17; MpV17 mitochondrial inner membrane protein; MpV17 transgene, murine homolog, glomerulosclerosis; protein Mpv17; glomerulosclerosis; SYM1; |
| Gene ID | 4358 |
| mRNA Refseq | NM_002437 |
| Protein Refseq | NP_002428 |
| MIM | 137960 |
| Uniprot ID | P39210 |
| Chromosome Location | 2p23.3 |
| Pathway | Peroxisome, organism-specific biosystem; Peroxisome, conserved biosystem; |
| Function | molecular_function; |
| ◆ Recombinant Proteins | ||
| RFL4587RF | Recombinant Full Length Rat Protein Mpv17(Mpv17) Protein, His-Tagged | +Inquiry |
| MPV17-6335HF | Recombinant Full Length Human MPV17 Protein, GST-tagged | +Inquiry |
| MPV17-312HF | Recombinant Full Length Human MPV17 Protein | +Inquiry |
| MPV17-11382Z | Recombinant Zebrafish MPV17 | +Inquiry |
| RFL13504DF | Recombinant Full Length Danio Rerio Protein Mpv17(Mpv17) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MPV17-4222HCL | Recombinant Human MPV17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPV17 Products
Required fields are marked with *
My Review for All MPV17 Products
Required fields are marked with *
