Recombinant Human MPZL1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MPZL1-2360H
Product Overview : MPZL1 MS Standard C13 and N15-labeled recombinant protein (NP_003944) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Cell surface receptor, which is involved in signal transduction processes. Recruits PTPN11/SHP-2 to the cell membrane and is a putative substrate of PTPN11/SHP-2. Is a major receptor for concanavalin-A (ConA) and is involved in cellular signaling induced by ConA, which probably includes Src family tyrosine-protein kinases. Isoform 3 seems to have a dominant negative role; it blocks tyrosine phosphorylation of MPZL1 induced by ConA. Isoform 1, but not isoform 2 and isoform 3, may be involved in regulation of integrin-mediated cell motility.
Molecular Mass : 29.1 kDa
AA Sequence : MAASAGAGAVIAAPDSRRWLWSVLAAALGLLTAGVSALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPVFPVWVVVGIVTAVVLGLTLLISMILAVLYRRKNSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MPZL1 myelin protein zero-like 1 [ Homo sapiens (human) ]
Official Symbol MPZL1
Synonyms MPZL1; myelin protein zero-like 1; myelin protein zero-like protein 1; FLJ21047; PZR; protein zero related; protein zero-related; immunoglobulin family transmembrane protein; PZRa; PZRb; PZR1b; MPZL1b;
Gene ID 9019
mRNA Refseq NM_003953
Protein Refseq NP_003944
MIM 604376
UniProt ID O95297

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MPZL1 Products

Required fields are marked with *

My Review for All MPZL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon