Recombinant Human MPZL1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MPZL1-2360H |
Product Overview : | MPZL1 MS Standard C13 and N15-labeled recombinant protein (NP_003944) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Cell surface receptor, which is involved in signal transduction processes. Recruits PTPN11/SHP-2 to the cell membrane and is a putative substrate of PTPN11/SHP-2. Is a major receptor for concanavalin-A (ConA) and is involved in cellular signaling induced by ConA, which probably includes Src family tyrosine-protein kinases. Isoform 3 seems to have a dominant negative role; it blocks tyrosine phosphorylation of MPZL1 induced by ConA. Isoform 1, but not isoform 2 and isoform 3, may be involved in regulation of integrin-mediated cell motility. |
Molecular Mass : | 29.1 kDa |
AA Sequence : | MAASAGAGAVIAAPDSRRWLWSVLAAALGLLTAGVSALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPVFPVWVVVGIVTAVVLGLTLLISMILAVLYRRKNSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MPZL1 myelin protein zero-like 1 [ Homo sapiens (human) ] |
Official Symbol | MPZL1 |
Synonyms | MPZL1; myelin protein zero-like 1; myelin protein zero-like protein 1; FLJ21047; PZR; protein zero related; protein zero-related; immunoglobulin family transmembrane protein; PZRa; PZRb; PZR1b; MPZL1b; |
Gene ID | 9019 |
mRNA Refseq | NM_003953 |
Protein Refseq | NP_003944 |
MIM | 604376 |
UniProt ID | O95297 |
◆ Recombinant Proteins | ||
MPZL1-3403R | Recombinant Rat MPZL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MPZL1-3745R | Recombinant Rat MPZL1 Protein | +Inquiry |
Mpzl1-4132M | Recombinant Mouse Mpzl1 Protein, Myc/DDK-tagged | +Inquiry |
RFL28399HF | Recombinant Full Length Human Myelin Protein Zero-Like Protein 1(Mpzl1) Protein, His-Tagged | +Inquiry |
MPZL1-5659M | Recombinant Mouse MPZL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPZL1-4218HCL | Recombinant Human MPZL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPZL1 Products
Required fields are marked with *
My Review for All MPZL1 Products
Required fields are marked with *