Recombinant Human MRGPRF protein, GST-tagged
Cat.No. : | MRGPRF-301214H |
Product Overview : | Recombinant Human MRGPRF (295-343 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Gly295-Ser343 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | GRDKSQRLWEPLRVVFQRALRDGAELGEAGGSTPNTVTMEMQCPPGNAS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MRGPRF MAS-related GPR, member F [ Homo sapiens ] |
Official Symbol | MRGPRF |
Synonyms | MRGPRF; MAS-related GPR, member F; G protein coupled receptor 140 , G protein coupled receptor 168 , GPR140, GPR168; mas-related G-protein coupled receptor member F; MGC21621; mrgF; mas-related gene F protein; G protein-coupled receptor 140; G protein-coupled receptor 168; G-protein coupled receptor 140; G-protein coupled receptor 168; G protein-coupled receptor MrgF; mas-related G protein-coupled MRGF; seven transmembrane helix receptor; RTA; MRGF; GPR140; GPR168; FLJ16111; FLJ29034; FLJ40998; FLJ53714; DKFZp586B2122; |
Gene ID | 116535 |
mRNA Refseq | NM_001098515 |
Protein Refseq | NP_001091985 |
MIM | 607233 |
UniProt ID | Q96AM1 |
◆ Recombinant Proteins | ||
RFL10379MF | Recombinant Full Length Mouse Mas-Related G-Protein Coupled Receptor Member F(Mrgprf) Protein, His-Tagged | +Inquiry |
Mrgprf-4140M | Recombinant Mouse Mrgprf Protein, Myc/DDK-tagged | +Inquiry |
MRGPRF-301214H | Recombinant Human MRGPRF protein, GST-tagged | +Inquiry |
MRGPRF-3415R | Recombinant Rat MRGPRF Protein, His (Fc)-Avi-tagged | +Inquiry |
MRGPRF-10033M | Recombinant Mouse MRGPRF Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRGPRF-4205HCL | Recombinant Human MRGPRF 293 Cell Lysate | +Inquiry |
MRGPRF-1091HCL | Recombinant Human MRGPRF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRGPRF Products
Required fields are marked with *
My Review for All MRGPRF Products
Required fields are marked with *