Recombinant Human MRGPRF protein, GST-tagged
Cat.No. : | MRGPRF-301214H |
Product Overview : | Recombinant Human MRGPRF (295-343 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
Source : | E. coli |
Species : | Human |
Tag : | GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Protein length : | Gly295-Ser343 |
AA Sequence : | GRDKSQRLWEPLRVVFQRALRDGAELGEAGGSTPNTVTMEMQCPPGNAS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name : | MRGPRF MAS-related GPR, member F [ Homo sapiens ] |
Official Symbol : | MRGPRF |
Synonyms : | MRGPRF; MAS-related GPR, member F; G protein coupled receptor 140 , G protein coupled receptor 168 , GPR140, GPR168; mas-related G-protein coupled receptor member F; MGC21621; mrgF; mas-related gene F protein; G protein-coupled receptor 140; G protein-coupled receptor 168; G-protein coupled receptor 140; G-protein coupled receptor 168; G protein-coupled receptor MrgF; mas-related G protein-coupled MRGF; seven transmembrane helix receptor; RTA; MRGF; GPR140; GPR168; FLJ16111; FLJ29034; FLJ40998; FLJ53714; DKFZp586B2122; |
Gene ID : | 116535 |
mRNA Refseq : | NM_001098515 |
Protein Refseq : | NP_001091985 |
MIM : | 607233 |
UniProt ID : | Q96AM1 |
Products Types
◆ Recombinant Protein | ||
MRGPRF-5543H | Recombinant Human MRGPRF Protein, GST-tagged | +Inquiry |
Mrgprf-4140M | Recombinant Mouse Mrgprf Protein, Myc/DDK-tagged | +Inquiry |
MRGPRF-5677M | Recombinant Mouse MRGPRF Protein, His (Fc)-Avi-tagged | +Inquiry |
MRGPRF-3415R | Recombinant Rat MRGPRF Protein, His (Fc)-Avi-tagged | +Inquiry |
MRGPRF-10033M | Recombinant Mouse MRGPRF Protein | +Inquiry |
◆ Lysates | ||
MRGPRF-1091HCL | Recombinant Human MRGPRF cell lysate | +Inquiry |
MRGPRF-4205HCL | Recombinant Human MRGPRF 293 Cell Lysate | +Inquiry |
◆ Assay kits | ||
Kit-1424 | MRGPRF CHO-K1 β-Arrestin Orphan GPCR Assay Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket