Recombinant Human MRGPRF protein, GST-tagged

Cat.No. : MRGPRF-301214H
Product Overview : Recombinant Human MRGPRF (295-343 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Gly295-Ser343
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : GRDKSQRLWEPLRVVFQRALRDGAELGEAGGSTPNTVTMEMQCPPGNAS
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name MRGPRF MAS-related GPR, member F [ Homo sapiens ]
Official Symbol MRGPRF
Synonyms MRGPRF; MAS-related GPR, member F; G protein coupled receptor 140 , G protein coupled receptor 168 , GPR140, GPR168; mas-related G-protein coupled receptor member F; MGC21621; mrgF; mas-related gene F protein; G protein-coupled receptor 140; G protein-coupled receptor 168; G-protein coupled receptor 140; G-protein coupled receptor 168; G protein-coupled receptor MrgF; mas-related G protein-coupled MRGF; seven transmembrane helix receptor; RTA; MRGF; GPR140; GPR168; FLJ16111; FLJ29034; FLJ40998; FLJ53714; DKFZp586B2122;
Gene ID 116535
mRNA Refseq NM_001098515
Protein Refseq NP_001091985
MIM 607233
UniProt ID Q96AM1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MRGPRF Products

Required fields are marked with *

My Review for All MRGPRF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon