Recombinant Human MRGPRF protein, GST-tagged

• Cat.No.: MRGPRF-301214H
• Product Overview: Recombinant Human MRGPRF (295-343 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Gly295-Ser343
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: GRDKSQRLWEPLRVVFQRALRDGAELGEAGGSTPNTVTMEMQCPPGNAS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: MRGPRF MAS-related GPR, member F [ Homo sapiens ]
• Official Symbol: MRGPRF
• Synonyms: MRGPRF; MAS-related GPR, member F; G protein coupled receptor 140 , G protein coupled receptor 168 , GPR140, GPR168; mas-related G-protein coupled receptor member F; MGC21621; mrgF; mas-related gene F protein; G protein-coupled receptor 140; G protein-coupled receptor 168; G-protein coupled receptor 140; G-protein coupled receptor 168; G protein-coupled receptor MrgF; mas-related G protein-coupled MRGF; seven transmembrane helix receptor; RTA; MRGF; GPR140; GPR168; FLJ16111; FLJ29034; FLJ40998; FLJ53714; DKFZp586B2122
• Gene ID: 116535
• mRNA Refseq: NM_001098515
• Protein Refseq: NP_001091985
• MIM: 607233
• UniProt ID: Q96AM1