Recombinant Human MRPL12 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MRPL12-4876H
• Product Overview: MRPL12 MS Standard C13 and N15-labeled recombinant protein (NP_002940) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein which forms homodimers. In prokaryotic ribosomes, two L7/L12 dimers and one L10 protein form the L8 protein complex.
• Molecular Mass: 21.3 kDa
• AA Sequence: MLPAAARPLWGPCLGLRAAAFRLARRQVPCVCAVRHMRSSGHQRCEALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLVPMGGVMSGAVPAAAAQEAVEEDIPIAKERTHFTVRLTEAKPVDKVKLIKEIKNYIQGINLVQAKKLVESLPQEIKANVAKAEAEKIKAALEAVGGTVVLETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MRPL12 mitochondrial ribosomal protein L12 [ Homo sapiens (human) ]
• Official Symbol: MRPL12
• Synonyms: MRPL12; mitochondrial ribosomal protein L12; RPML12; 39S ribosomal protein L12, mitochondrial; MRPL7; MRPL7/L12; MRP-L12; 5c5-2; L12mt; MRP-L31/34; MGC8610; FLJ60124
• Gene ID: 6182
• mRNA Refseq: NM_002949
• Protein Refseq: NP_002940
• MIM: 602375
• UniProt ID: P52815