Recombinant Human MRPL20 Protein, GST-tagged
Cat.No. : | MRPL20-5565H |
Product Overview : | Human MRPL20 full-length ORF ( NP_060441.2, 1 a.a. - 149 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. A pseudogene corresponding to this gene is found on chromosome 21q. [provided by RefSeq |
Molecular Mass : | 43.8 kDa |
AA Sequence : | MVFLTAQLWLRNRVTDRYFRIQEVLKHARHFRGRKNRCYRLAVRTVIRAFVKCTKARYLKKKNMRTLWINRITAASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRRRHEGFAAALGDGKEPEGIFSRVVQYH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MRPL20 mitochondrial ribosomal protein L20 [ Homo sapiens ] |
Official Symbol | MRPL20 |
Synonyms | L20mt; MRP-L20; MRPL20; mitochondrial ribosomal protein L20 |
Gene ID | 55052 |
mRNA Refseq | NM_017971 |
Protein Refseq | NP_060441 |
MIM | 611833 |
UniProt ID | Q9BYC9 |
◆ Recombinant Proteins | ||
MRPL20-6402HF | Recombinant Full Length Human MRPL20 Protein, GST-tagged | +Inquiry |
MRPL20-2838R | Recombinant Rhesus monkey MRPL20 Protein, His-tagged | +Inquiry |
MRPL20-1087H | Recombinant Human MRPL20 | +Inquiry |
MRPL20-3509H | Recombinant Human MRPL20 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPL20-2658R | Recombinant Rhesus Macaque MRPL20 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL20-4189HCL | Recombinant Human MRPL20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRPL20 Products
Required fields are marked with *
My Review for All MRPL20 Products
Required fields are marked with *
0
Inquiry Basket