Recombinant Human MRPL24 Protein, GST-tagged
Cat.No. : | MRPL24-5569H |
Product Overview : | Human MRPL24 full-length ORF ( NP_078816.2, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein which is more than twice the size of its E.coli counterpart (EcoL24). Sequence analysis identified two transcript variants that encode the same protein. [provided by RefSeq |
Molecular Mass : | 51.3 kDa |
AA Sequence : | MRLSALLALASKVTLPPHYRYGMSPPGSVADKRKNPPWIRRRPVVVEPISDEDWYLFCGDTVEILEGKDAGKQGKVVQVIRQRNWVVVGGLNTHYRYIGKTMDYRGTMIPSEAPLLHRQVKLVDPMDRKPTEIEWRFTEAGERVRVSTRSGRIIPKPEFPRADGIVPETWIDGPKDTSVEDALERTYVPCLKTLQEEVMEAMGIKETRKYKKVYWY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MRPL24 mitochondrial ribosomal protein L24 [ Homo sapiens ] |
Official Symbol | MRPL24 |
Synonyms | MRPL24; mitochondrial ribosomal protein L24; MRP-L18; |
Gene ID | 64991 |
◆ Recombinant Proteins | ||
MRPL24-3511H | Recombinant Human MRPL24 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPL24-6416HF | Recombinant Full Length Human MRPL24 Protein, GST-tagged | +Inquiry |
MRPL24-3769R | Recombinant Rat MRPL24 Protein | +Inquiry |
MRPL24-538Z | Recombinant Zebrafish MRPL24 | +Inquiry |
MRPL24-5569H | Recombinant Human MRPL24 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL24-4185HCL | Recombinant Human MRPL24 293 Cell Lysate | +Inquiry |
MRPL24-4184HCL | Recombinant Human MRPL24 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPL24 Products
Required fields are marked with *
My Review for All MRPL24 Products
Required fields are marked with *