Recombinant Human MRPL36 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MRPL36-972H
Product Overview : MRPL36 MS Standard C13 and N15-labeled recombinant protein (NP_115868) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. A pseudogene corresponding to this gene is found on chromosome 2p.
Molecular Mass : 11.8 kDa
AA Sequence : MANLFIRKMVNPLLYLSRHTVKPRALSTFLFGSIRGAAPVAVEPGAAVRSLLSPGLLPHLLPALGFKNKTVLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MRPL36 mitochondrial ribosomal protein L36 [ Homo sapiens (human) ]
Official Symbol MRPL36
Synonyms MRPL36; mitochondrial ribosomal protein L36; RPMJ; BRIP1; L36mt; PRPL36; MRP-L36; 39S ribosomal protein L36, mitochondrial; BRCA1-interacting protein 1; mitochondrial large ribosomal subunit protein bL36m; putative BRCA1-interacting protein
Gene ID 64979
mRNA Refseq NM_032479
Protein Refseq NP_115868
MIM 611842
UniProt ID Q9P0J6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MRPL36 Products

Required fields are marked with *

My Review for All MRPL36 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon