Recombinant Human MRPL36 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | MRPL36-972H |
| Product Overview : | MRPL36 MS Standard C13 and N15-labeled recombinant protein (NP_115868) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. A pseudogene corresponding to this gene is found on chromosome 2p. |
| Molecular Mass : | 11.8 kDa |
| AA Sequence : | MANLFIRKMVNPLLYLSRHTVKPRALSTFLFGSIRGAAPVAVEPGAAVRSLLSPGLLPHLLPALGFKNKTVLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | MRPL36 mitochondrial ribosomal protein L36 [ Homo sapiens (human) ] |
| Official Symbol | MRPL36 |
| Synonyms | MRPL36; mitochondrial ribosomal protein L36; RPMJ; BRIP1; L36mt; PRPL36; MRP-L36; 39S ribosomal protein L36, mitochondrial; BRCA1-interacting protein 1; mitochondrial large ribosomal subunit protein bL36m; putative BRCA1-interacting protein |
| Gene ID | 64979 |
| mRNA Refseq | NM_032479 |
| Protein Refseq | NP_115868 |
| MIM | 611842 |
| UniProt ID | Q9P0J6 |
| ◆ Recombinant Proteins | ||
| MRPL36-1000H | Recombinant Human MRPL36, His-tagged | +Inquiry |
| MRPL36-1093H | Recombinant Human MRPL36 | +Inquiry |
| MRPL36-3770R | Recombinant Rat MRPL36 Protein | +Inquiry |
| MRPL36-2664R | Recombinant Rhesus Macaque MRPL36 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MRPL36-3516H | Recombinant Human MRPL36 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MRPL36-4175HCL | Recombinant Human MRPL36 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPL36 Products
Required fields are marked with *
My Review for All MRPL36 Products
Required fields are marked with *
