Recombinant Human MRPS15 protein, His-tagged
Cat.No. : | MRPS15-6732H |
Product Overview : | Recombinant Human MRPS15 protein(1-257 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-257 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MLRVAWRTLSLIRTRAVTQVLVPGLPGGGSAKFPFNQWGLQPRSLLLQAARGYVVRKPAQSRLDDDPPPSTLLKDYQNVPGIEKVDDVVKRLLSLEMANKKEMLKIKQEQFMKKIVANPEDTRSLEARIIALSVKIRSYEEHLEKHRKDKAHKRYLLMSIDQRKKMLKNLRNTNYDVFEKICWGLGIEYTFPPLYYRRAHRRFVTKKALCIRVFQETQKLKKRRRALKAAAAAQKQAKRRNPDSPAKAIPKTLKDSQ |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | MRPS15 mitochondrial ribosomal protein S15 [ Homo sapiens ] |
Official Symbol | MRPS15 |
Synonyms | MRPS15; mitochondrial ribosomal protein S15; 28S ribosomal protein S15, mitochondrial; FLJ11564; MRP-S15; DC37; S15mt; RPMS15; MPR-S15; |
Gene ID | 64960 |
mRNA Refseq | NM_031280 |
Protein Refseq | NP_112570 |
MIM | 611979 |
UniProt ID | P82914 |
◆ Recombinant Proteins | ||
MRPS15-613Z | Recombinant Zebrafish MRPS15 | +Inquiry |
MRPS15-1021H | Recombinant Human MRPS15, GST-tagged | +Inquiry |
MRPS15-3778R | Recombinant Rat MRPS15 Protein | +Inquiry |
MRPS15-6467HF | Recombinant Full Length Human MRPS15 Protein, GST-tagged | +Inquiry |
MRPS15-1108H | Recombinant Human MRPS15 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPS15-4150HCL | Recombinant Human MRPS15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPS15 Products
Required fields are marked with *
My Review for All MRPS15 Products
Required fields are marked with *