Recombinant Human MRPS17 protein, GST-tagged
Cat.No. : | MRPS17-30156H |
Product Overview : | Recombinant Human MRPS17 (1-130 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Gln130 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MSVVRSSVHARWIVGKVIGTKMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTVGDIVLLRALPVPRAKHVKHELAEIVFKVGKVIDPVTGKPCAGTTYLESPLSSETTQLSKNLEELNISSAQ |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | MRPS17 mitochondrial ribosomal protein S17 [ Homo sapiens ] |
Official Symbol | MRPS17 |
Synonyms | MRPS17; mitochondrial ribosomal protein S17; 28S ribosomal protein S17, mitochondrial; 28S ribosomal protein S17; mitochondrial; HSPC011; MRP S17; RPMS17; S17mt; MRP-S17; |
Gene ID | 51373 |
mRNA Refseq | NM_015969 |
Protein Refseq | NP_057053 |
MIM | 611980 |
UniProt ID | Q9Y2R5 |
◆ Recombinant Proteins | ||
MRPS17-2601H | Recombinant Human MRPS17 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MRPS17-10088M | Recombinant Mouse MRPS17 Protein | +Inquiry |
MRPS17-5605H | Recombinant Human MRPS17 Protein, GST-tagged | +Inquiry |
MRPS17-1023H | Recombinant Human MRPS17, His-tagged | +Inquiry |
MRPS17-2676R | Recombinant Rhesus Macaque MRPS17 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPS17 Products
Required fields are marked with *
My Review for All MRPS17 Products
Required fields are marked with *
0
Inquiry Basket