Recombinant Human MRPS17 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MRPS17-2601H
Product Overview : MRPS17 MS Standard C13 and N15-labeled recombinant protein (NP_057053) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S17P family. The encoded protein is moderately conserved between human mitochondrial and prokaryotic ribosomal proteins. Pseudogenes corresponding to this gene are found on chromosomes 1p, 3p, 6q, 14p, 18q, and Xq.
Molecular Mass : 14.5 kDa
AA Sequence : MSVVRSSVHARWIVGKVIGTKMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTVGDIVLLRALPVPRAKHVKHELAEIVFKVGKVIDPVTGKPCAGTTYLESPLSSETTQLSKNLEELNISSAQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MRPS17 mitochondrial ribosomal protein S17 [ Homo sapiens (human) ]
Official Symbol MRPS17
Synonyms MRPS17; mitochondrial ribosomal protein S17; 28S ribosomal protein S17, mitochondrial; 28S ribosomal protein S17; mitochondrial; HSPC011; MRP S17; RPMS17; S17mt; MRP-S17;
Gene ID 51373
mRNA Refseq NM_015969
Protein Refseq NP_057053
MIM 611980
UniProt ID Q9Y2R5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MRPS17 Products

Required fields are marked with *

My Review for All MRPS17 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon