Recombinant Human MRPS21 Protein, GST-tagged
Cat.No. : | MRPS21-5609H |
Product Overview : | Human MRPS21 full-length ORF ( AAH04566, 1 a.a. - 87 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S21P family. Pseudogenes corresponding to this gene are found on chromosomes 1p, 1q, 9p, 10p, 10q, 16q, and 17q. Available sequence data analyses identified splice variants that differ in the 5 UTR; both transcripts encode the same protein. [provided by RefSeq |
Molecular Mass : | 35.31 kDa |
AA Sequence : | MAKHLKFIARTVMVQEGNVESAYRTLNRILTMDGLIEDIKHRRYYEKPCRRRQRESYERCRRIYNMEMARKINFLMRKNRADPWQGC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MRPS21 mitochondrial ribosomal protein S21 [ Homo sapiens ] |
Official Symbol | MRPS21 |
Synonyms | MRPS21; mitochondrial ribosomal protein S21; 28S ribosomal protein S21, mitochondrial; S21mt; mitochondrial 28S ribosomal protein S21; MDS016; RPMS21; MRP-S21; |
Gene ID | 54460 |
mRNA Refseq | NM_018997 |
Protein Refseq | NP_061870 |
MIM | 611984 |
UniProt ID | P82921 |
◆ Recombinant Proteins | ||
MRPS21-5718M | Recombinant Mouse MRPS21 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPS21-1028H | Recombinant Human MRPS21, His-tagged | +Inquiry |
MRPS21-5266C | Recombinant Chicken MRPS21 | +Inquiry |
MRPS21-6482HF | Recombinant Full Length Human MRPS21 Protein, GST-tagged | +Inquiry |
MRPS21-2860R | Recombinant Rhesus monkey MRPS21 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPS21-4145HCL | Recombinant Human MRPS21 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPS21 Products
Required fields are marked with *
My Review for All MRPS21 Products
Required fields are marked with *