Recombinant Human MRPS27 protein, GST-tagged
| Cat.No. : | MRPS27-516H |
| Product Overview : | Recombinant Human MRPS27 protein(NP_055899)(1-168 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-168 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | MPLIWKPGYLDRALQVMEKVAASPEDIKLCREALDVLGAVLKALTSADGASEEQSQNDEDNQGSEKLVEQLDIEETEQSKLPQYLERFKALHSKLQALGKIESEGLLSLTTQLVKEKLSTCEAEDIATYEQNLQQWHLDLVQLIQREQQQREQAKQEYQAQKAAKASA |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). |
| Gene Name | MRPS27 mitochondrial ribosomal protein S27 [ Homo sapiens ] |
| Official Symbol | MRPS27 |
| Synonyms | MRPS27; mitochondrial ribosomal protein S27; 28S ribosomal protein S27, mitochondrial; KIAA0264; mitochondrial 28S ribosomal protein S27; S27mt; MRP-S27; FLJ21764; FLJ23348; FLJ38645; |
| Gene ID | 23107 |
| mRNA Refseq | NM_015084 |
| Protein Refseq | NP_055899 |
| MIM | 611989 |
| UniProt ID | Q92552 |
| ◆ Recombinant Proteins | ||
| MRPS27-6495HF | Recombinant Full Length Human MRPS27 Protein, GST-tagged | +Inquiry |
| MRPS27-10098M | Recombinant Mouse MRPS27 Protein | +Inquiry |
| MRPS27-1938H | Recombinant Human MRPS27 Protein, His-tagged | +Inquiry |
| MRPS27-5722M | Recombinant Mouse MRPS27 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MRPS27-5616H | Recombinant Human MRPS27 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MRPS27-4139HCL | Recombinant Human MRPS27 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPS27 Products
Required fields are marked with *
My Review for All MRPS27 Products
Required fields are marked with *
