Recombinant Human MRPS7 Protein, GST-tagged
Cat.No. : | MRPS7-5626H |
Product Overview : | Human MRPS7 full-length ORF ( NP_057055.1, 1 a.a. - 242 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. In the prokaryotic ribosome, the comparable protein is thought to play an essential role in organizing the 3 domain of the 16 S rRNA in the vicinity of the P- and A-sites. Pseudogenes corresponding to this gene are found on chromosomes 8p and 12p. [provided by RefSeq |
Molecular Mass : | 54.6 kDa |
AA Sequence : | MVAPAVKVARGWSGLALGVRRAVLQLPGLTQVRWSRYSPEFKDPLIDKEYYRKPVEELTEEEKYVRELKKTQLIKAAPAGKTSSVFEDPVISKFTNMMMIGGNKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERNPYTIFHQALKNCEPMIGLVPILKGGRFYQVPVPLPDRRRRFLAMKWMITECRDKKHQRTLMPEKLSHKLLEAFHNQGPVIKRKHDLHKMAEANRALAHYRWW |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MRPS7 mitochondrial ribosomal protein S7 [ Homo sapiens ] |
Official Symbol | MRPS7 |
Synonyms | MRPS7; mitochondrial ribosomal protein S7; RP-S7; RPMS7; MRP-S7; |
Gene ID | 64967 |
◆ Recombinant Proteins | ||
MRPS7-3441R | Recombinant Rat MRPS7 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPS7-3782R | Recombinant Rat MRPS7 Protein | +Inquiry |
MRPS7-6510HF | Recombinant Full Length Human MRPS7 Protein, GST-tagged | +Inquiry |
MRPS7-2689R | Recombinant Rhesus Macaque MRPS7 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPS7-2869R | Recombinant Rhesus monkey MRPS7 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPS7-4131HCL | Recombinant Human MRPS7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRPS7 Products
Required fields are marked with *
My Review for All MRPS7 Products
Required fields are marked with *
0
Inquiry Basket