Recombinant Human MS4A1, GST-tagged
| Cat.No. : | MS4A1-10H |
| Product Overview : | Recombinant Human MS4A1 encoding human MS4A1 full-length ORF (1 a.a. - 297 a.a.) produced in in vitro wheat germ expression system, was fused a GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This gene encodes a B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. This family member is localized to 11q12, among a cluster of family members. Alternative splicing of this gene results in two transcript variants which encode the same protein. |
| Sequence : | MTTPRNSVNGTFPAEPMKGPIAMQSGPKPLFRRMSSLVGPTQSFFMRES KTLGAVQIMNGLFHIALGGLLMIPAGIYAPICVTVWYPLWGGIMYIISGSLLAA TEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRA HTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIFAFFQELVIAGI VENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDI EIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP |
| Purification : | Glutathione Sepharose 4 Fast Flow |
| MolecularWeight : | 58.41 kDa |
| Applications : | ELISA; WB |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH8.0 in the elution buffer. |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | MS4A1 membrane-spanning 4-domains, subfamily A, member 1 [ Homo sapiens ] |
| Official Symbol | MS4A1 |
| Synonyms | MS4A1; membrane-spanning 4-domains, subfamily A, member 1; B1; S7; Bp35; CD20; CVID5; MS4A2; LEU-16; B-lymphocyte antigen CD20; CD20 antigen; CD20 receptor; leukocyte surface antigen Leu-16; B-lymphocyte cell-surface antigen B1; MGC3969; OTTHUMP00000236377; OTTHUMP00000236378 |
| Gene ID | 931 |
| mRNA Refseq | NM_021950 |
| Protein Refseq | NP_068769 |
| MIM | 118910 |
| UniProt ID | P11836 |
| Chromosome Location | 11q12 |
| Pathway | Hematopoietic cell lineage |
| Function | epidermal growth factor receptor binding |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MS4A1 Products
Required fields are marked with *
My Review for All MS4A1 Products
Required fields are marked with *



