Recombinant Human MS4A7 protein, His-tagged
Cat.No. : | MS4A7-3330H |
Product Overview : | Recombinant Human MS4A7 protein(1-240 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-240 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTETTVLGTVQILCCLLISSLGAILVFAPYPSHFNPAISTTLMSGYPFLGALCFGITGSLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGVLVVMLIFTVLELLLAAYSSVFWWKQLYSNNPGSSFSSTQSQDHIQQVKKSSSRSWI |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MS4A7 membrane-spanning 4-domains, subfamily A, member 7 [ Homo sapiens ] |
Official Symbol | MS4A7 |
Synonyms | MS4A7; membrane-spanning 4-domains, subfamily A, member 7; membrane-spanning 4-domains subfamily A member 7; CD20L4; CFFM4; MS4A8; CD20 antigen-like 4; four-span transmembrane protein 2; CD20/Fc-epsilon-RI-beta family member 4; high affinity immunoglobulin epsilon receptor beta subunit; 4SPAN2; MGC22368; |
Gene ID | 58475 |
mRNA Refseq | NM_021201 |
Protein Refseq | NP_067024 |
MIM | 606502 |
UniProt ID | Q9GZW8 |
◆ Recombinant Proteins | ||
MS4A7-2384H | Recombinant Human MS4A7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MS4A7-3330H | Recombinant Human MS4A7 protein, His-tagged | +Inquiry |
MS4A7-1937H | Recombinant Human MS4A7 Protein, MYC/DDK-tagged | +Inquiry |
MS4A7-2872R | Recombinant Rhesus monkey MS4A7 Protein, His-tagged | +Inquiry |
MS4A7-1053H | Recombinant Human MS4A7, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MS4A7-421HCL | Recombinant Human MS4A7 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MS4A7 Products
Required fields are marked with *
My Review for All MS4A7 Products
Required fields are marked with *
0
Inquiry Basket