Recombinant Human MS4A7 protein, His-tagged
| Cat.No. : | MS4A7-3330H |
| Product Overview : | Recombinant Human MS4A7 protein(1-240 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | December 23, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-240 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTETTVLGTVQILCCLLISSLGAILVFAPYPSHFNPAISTTLMSGYPFLGALCFGITGSLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGVLVVMLIFTVLELLLAAYSSVFWWKQLYSNNPGSSFSSTQSQDHIQQVKKSSSRSWI |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | MS4A7 membrane-spanning 4-domains, subfamily A, member 7 [ Homo sapiens ] |
| Official Symbol | MS4A7 |
| Synonyms | MS4A7; membrane-spanning 4-domains, subfamily A, member 7; membrane-spanning 4-domains subfamily A member 7; CD20L4; CFFM4; MS4A8; CD20 antigen-like 4; four-span transmembrane protein 2; CD20/Fc-epsilon-RI-beta family member 4; high affinity immunoglobulin epsilon receptor beta subunit; 4SPAN2; MGC22368; |
| Gene ID | 58475 |
| mRNA Refseq | NM_021201 |
| Protein Refseq | NP_067024 |
| MIM | 606502 |
| UniProt ID | Q9GZW8 |
| ◆ Recombinant Proteins | ||
| MS4A7-6551HF | Recombinant Full Length Human MS4A7 Protein, GST-tagged | +Inquiry |
| MS4A7-5643H | Recombinant Human MS4A7 Protein, GST-tagged | +Inquiry |
| MS4A7-1937H | Recombinant Human MS4A7 Protein, MYC/DDK-tagged | +Inquiry |
| RFL2853HF | Recombinant Full Length Human Membrane-Spanning 4-Domains Subfamily A Member 7(Ms4A7) Protein, His-Tagged | +Inquiry |
| MS4A7-2692R | Recombinant Rhesus Macaque MS4A7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MS4A7-421HCL | Recombinant Human MS4A7 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MS4A7 Products
Required fields are marked with *
My Review for All MS4A7 Products
Required fields are marked with *
