Recombinant Human MS4A7 protein, His-tagged

Cat.No. : MS4A7-3330H
Product Overview : Recombinant Human MS4A7 protein(1-240 aa), fused to His tag, was expressed in E. coli.
Availability July 04, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-240 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTETTVLGTVQILCCLLISSLGAILVFAPYPSHFNPAISTTLMSGYPFLGALCFGITGSLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGVLVVMLIFTVLELLLAAYSSVFWWKQLYSNNPGSSFSSTQSQDHIQQVKKSSSRSWI
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name MS4A7 membrane-spanning 4-domains, subfamily A, member 7 [ Homo sapiens ]
Official Symbol MS4A7
Synonyms MS4A7; membrane-spanning 4-domains, subfamily A, member 7; membrane-spanning 4-domains subfamily A member 7; CD20L4; CFFM4; MS4A8; CD20 antigen-like 4; four-span transmembrane protein 2; CD20/Fc-epsilon-RI-beta family member 4; high affinity immunoglobulin epsilon receptor beta subunit; 4SPAN2; MGC22368;
Gene ID 58475
mRNA Refseq NM_021201
Protein Refseq NP_067024
MIM 606502
UniProt ID Q9GZW8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MS4A7 Products

Required fields are marked with *

My Review for All MS4A7 Products

Required fields are marked with *

0
cart-icon