Recombinant Human MSH6, GST-tagged

Cat.No. : MSH6-2414H
Product Overview : Recombinant Human MSH6(931 a.a. - 1030 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the DNA mismatch repair MutS family. In E. coli, the MutS protein helps in the recognition of mismatched nucleotides prior to their repair. A highly conserved region of approximately 150 aa, called the Walker-A adenine nucleotide binding motif, exists in MutS homologs. The encoded protein heterodimerizes with MSH2 to form a mismatch recognition complex that functions as a bidirectional molecular switch that exchanges ADP and ATP as DNA mismatches are bound and dissociated. Mutations in this gene may be associated with hereditary nonpolyposis colon cancer, colorectal cancer, and endometrial cancer. Transcripts variants encoding different isoforms have been described.
Molecular Mass : 36.74 kDa
AA Sequence : AGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKR YWTKTIEKKLANLINAEERRDVSLK
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MSH6 mutS homolog 6 [ Homo sapiens (human) ]
Official Symbol MSH6
Synonyms MSH6; GTBP; HSAP; p160; GTMBP; HNPCC5; mutS homolog 6; DNA mismatch repair protein Msh6; sperm-associated protein; mutS-alpha 160 kDa subunit; G/T mismatch-binding protein
Gene ID 2956
mRNA Refseq NM_000179
Protein Refseq NP_000170
MIM 600678
UniProt ID P52701
Chromosome Location 2p16
Pathway BRCA1-associated genome surveillance complex (BASC); Colorectal cancer; Mismatch repair
Function contributes_to ADP binding; contributes_to ATPase activity; contributes_to MutLalpha complex binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MSH6 Products

Required fields are marked with *

My Review for All MSH6 Products

Required fields are marked with *

0
cart-icon
0
compare icon