Recombinant Human MSH6, GST-tagged
| Cat.No. : | MSH6-2414H |
| Product Overview : | Recombinant Human MSH6(931 a.a. - 1030 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 931-1030 aa |
| Description : | This gene encodes a member of the DNA mismatch repair MutS family. In E. coli, the MutS protein helps in the recognition of mismatched nucleotides prior to their repair. A highly conserved region of approximately 150 aa, called the Walker-A adenine nucleotide binding motif, exists in MutS homologs. The encoded protein heterodimerizes with MSH2 to form a mismatch recognition complex that functions as a bidirectional molecular switch that exchanges ADP and ATP as DNA mismatches are bound and dissociated. Mutations in this gene may be associated with hereditary nonpolyposis colon cancer, colorectal cancer, and endometrial cancer. Transcripts variants encoding different isoforms have been described. |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | AGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKR YWTKTIEKKLANLINAEERRDVSLK |
| Applications : | ELISA; WB-Re; AP; Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MSH6 mutS homolog 6 [ Homo sapiens (human) ] |
| Official Symbol | MSH6 |
| Synonyms | MSH6; GTBP; HSAP; p160; GTMBP; HNPCC5; mutS homolog 6; DNA mismatch repair protein Msh6; sperm-associated protein; mutS-alpha 160 kDa subunit; G/T mismatch-binding protein |
| Gene ID | 2956 |
| mRNA Refseq | NM_000179 |
| Protein Refseq | NP_000170 |
| MIM | 600678 |
| UniProt ID | P52701 |
| Chromosome Location | 2p16 |
| Pathway | BRCA1-associated genome surveillance complex (BASC); Colorectal cancer; Mismatch repair |
| Function | contributes_to ADP binding; contributes_to ATPase activity; contributes_to MutLalpha complex binding |
| ◆ Recombinant Proteins | ||
| MSH6-9649Z | Recombinant Zebrafish MSH6 | +Inquiry |
| MSH6-03H | Recombinant Human MSH6 Protein, N-His tagged | +Inquiry |
| MSH6-2693R | Recombinant Rhesus Macaque MSH6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MSH6-2873R | Recombinant Rhesus monkey MSH6 Protein, His-tagged | +Inquiry |
| MSH6-5740M | Recombinant Mouse MSH6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MSH6-4117HCL | Recombinant Human MSH6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSH6 Products
Required fields are marked with *
My Review for All MSH6 Products
Required fields are marked with *
