Recombinant Human MSN protein, His-tagged
Cat.No. : | MSN-3743H |
Product Overview : | Recombinant Human MSN protein(385-502 aa), fused to His tag, was expressed in E. coli. |
Availability | August 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 385-502 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | EAEKLAKERQEAEEAKEALLQASRDQKKTQEQLALEMAELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEASADLRADAMAKD |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MSN moesin [ Homo sapiens ] |
Official Symbol | MSN |
Synonyms | MSN; moesin; membrane-organizing extension spike protein; |
Gene ID | 4478 |
mRNA Refseq | NM_002444 |
Protein Refseq | NP_002435 |
MIM | 309845 |
UniProt ID | P26038 |
◆ Recombinant Proteins | ||
MSN-7364H | Recombinant Human MSN protein, His-tagged | +Inquiry |
MSN-5662H | Recombinant Human MSN Protein, GST-tagged | +Inquiry |
MSN-3743H | Recombinant Human MSN protein, His-tagged | +Inquiry |
MSN-2697R | Recombinant Rhesus Macaque MSN Protein, His (Fc)-Avi-tagged | +Inquiry |
Msn-4194M | Recombinant Mouse Msn Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSN-4110HCL | Recombinant Human MSN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSN Products
Required fields are marked with *
My Review for All MSN Products
Required fields are marked with *