Recombinant Human MSN protein, His-tagged
| Cat.No. : | MSN-3743H |
| Product Overview : | Recombinant Human MSN protein(385-502 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 29, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 385-502 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | EAEKLAKERQEAEEAKEALLQASRDQKKTQEQLALEMAELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEASADLRADAMAKD |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | MSN moesin [ Homo sapiens ] |
| Official Symbol | MSN |
| Synonyms | MSN; moesin; membrane-organizing extension spike protein; |
| Gene ID | 4478 |
| mRNA Refseq | NM_002444 |
| Protein Refseq | NP_002435 |
| MIM | 309845 |
| UniProt ID | P26038 |
| ◆ Recombinant Proteins | ||
| MSN-4606H | Recombinant Human MSN Protein (Met1-Met577), N-GST tagged | +Inquiry |
| MSN-4608H | Recombinant Human MSN Protein (Ile354-Met577), N-His tagged | +Inquiry |
| MSN-3743H | Recombinant Human MSN protein, His-tagged | +Inquiry |
| MSN-7364H | Recombinant Human MSN protein, His-tagged | +Inquiry |
| MSN-1443H | Recombinant Human MSN Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MSN-246HKCL | Human MSN Knockdown Cell Lysate | +Inquiry |
| MSN-4110HCL | Recombinant Human MSN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSN Products
Required fields are marked with *
My Review for All MSN Products
Required fields are marked with *
