Recombinant Human MSR1

• Cat.No.: MSR1-30164TH
• Product Overview: Recombinant fragment corresponding to amino acids 121-220 of Human Macrophage Scavenger Receptor I with a proprietary tag; Predicted MWt 36.63 kDa including tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: This gene encodes the class A macrophage scavenger receptors, which include three different types (1, 2, 3) generated by alternative splicing of this gene. These receptors or isoforms are macrophage-specific trimeric integral membrane glycoproteins and have been implicated in many macrophage-associated physiological and pathological processes including atherosclerosis, Alzheimers disease, and host defense. The isoforms type 1 and type 2 are functional receptors and are able to mediate the endocytosis of modified low density lipoproteins (LDLs). The isoform type 3 does not internalize modified LDL (acetyl-LDL) despite having the domain shown to mediate this function in the types 1 and 2 isoforms. It has an altered intracellular processing and is trapped within the endoplasmic reticulum, making it unable to perform endocytosis. The isoform type 3 can inhibit the function of isoforms type 1 and type 2 when co-expressed, indicating a dominant negative effect and suggesting a mechanism for regulation of scavenger receptor activity in macrophages.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Isoform I, isoform II and isoform III are expressed in monocyte-derived macrophages.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MEKRIQHILDMEANLMDTEHFQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSLISLNTTLLDLQLNIENLNGKIQENTFKQQEEISKLEERVY
• Sequence Similarities: Contains 1 collagen-like domain.Contains 1 SRCR domain.

Gene Information

• Gene Name: MSR1 macrophage scavenger receptor 1 [ Homo sapiens ]
• Official Symbol: MSR1
• Synonyms: MSR1; macrophage scavenger receptor 1; macrophage scavenger receptor types I and II; CD204; SCARA1
• Gene ID: 4481
• mRNA Refseq: NM_002445
• Protein Refseq: NP_002436
• MIM: 153622
• Uniprot ID: P21757
• Chromosome Location: 8p22
• Pathway: Phagosome, organism-specific biosystem; Phagosome, conserved biosystem
• Function: low-density lipoprotein particle binding; protein binding; receptor activity; scavenger receptor activity