Recombinant Human MSR1

Cat.No. : MSR1-30164TH
Product Overview : Recombinant fragment corresponding to amino acids 121-220 of Human Macrophage Scavenger Receptor I with a proprietary tag; Predicted MWt 36.63 kDa including tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes the class A macrophage scavenger receptors, which include three different types (1, 2, 3) generated by alternative splicing of this gene. These receptors or isoforms are macrophage-specific trimeric integral membrane glycoproteins and have been implicated in many macrophage-associated physiological and pathological processes including atherosclerosis, Alzheimers disease, and host defense. The isoforms type 1 and type 2 are functional receptors and are able to mediate the endocytosis of modified low density lipoproteins (LDLs). The isoform type 3 does not internalize modified LDL (acetyl-LDL) despite having the domain shown to mediate this function in the types 1 and 2 isoforms. It has an altered intracellular processing and is trapped within the endoplasmic reticulum, making it unable to perform endocytosis. The isoform type 3 can inhibit the function of isoforms type 1 and type 2 when co-expressed, indicating a dominant negative effect and suggesting a mechanism for regulation of scavenger receptor activity in macrophages.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Isoform I, isoform II and isoform III are expressed in monocyte-derived macrophages.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MEKRIQHILDMEANLMDTEHFQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSLISLNTTLLDLQLNIENLNGKIQENTFKQQEEISKLEERVY
Sequence Similarities : Contains 1 collagen-like domain.Contains 1 SRCR domain.
Gene Name MSR1 macrophage scavenger receptor 1 [ Homo sapiens ]
Official Symbol MSR1
Synonyms MSR1; macrophage scavenger receptor 1; macrophage scavenger receptor types I and II; CD204; SCARA1;
Gene ID 4481
mRNA Refseq NM_002445
Protein Refseq NP_002436
MIM 153622
Uniprot ID P21757
Chromosome Location 8p22
Pathway Phagosome, organism-specific biosystem; Phagosome, conserved biosystem;
Function low-density lipoprotein particle binding; protein binding; receptor activity; scavenger receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MSR1 Products

Required fields are marked with *

My Review for All MSR1 Products

Required fields are marked with *

0
cart-icon
0
compare icon