Recombinant Human MSR1 Protein, GST-tagged
Cat.No. : | MSR1-5664H |
Product Overview : | Human MSR1 partial ORF ( NP_619729, 121 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes the class A macrophage scavenger receptors, which include three different types (1, 2, 3) generated by alternative splicing of this gene. These receptors or isoforms are macrophage-specific trimeric integral membrane glycoproteins and have been implicated in many macrophage-associated physiological and pathological processes including atherosclerosis, Alzheimers disease, and host defense. The isoforms type 1 and type 2 are functional receptors and are able to mediate the endocytosis of modified low density lipoproteins (LDLs). The isoform type 3 does not internalize modified LDL (acetyl-LDL) despite having the domain shown to mediate this function in the types 1 and 2 isoforms. It has an altered intracellular processing and is trapped within the endoplasmic reticulum, making it unable to perform endocytosis. The isoform type 3 can inhibit the function of isoforms type 1 and type 2 when co-expressed, indicating a dominant negative effect and suggesting a mechanism for regulation of scavenger receptor activity in macrophages. [provided by RefSeq |
Molecular Mass : | 36.74 kDa |
AA Sequence : | MEKRIQHILDMEANLMDTEHFQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSLISLNTTLLDLQLNIENLNGKIQENTFKQQEEISKLKERVY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MSR1 macrophage scavenger receptor 1 [ Homo sapiens ] |
Official Symbol | MSR1 |
Synonyms | MSR1; macrophage scavenger receptor 1; macrophage scavenger receptor types I and II; CD204; SCARA1; scavenger receptor class A member 1; scavenger receptor class A, member 1; macrophage scavenger receptor type III; macrophage acetylated LDL receptor I and II; SRA; SR-A; phSR1; phSR2; |
Gene ID | 4481 |
mRNA Refseq | NM_138716 |
Protein Refseq | NP_619730 |
MIM | 153622 |
UniProt ID | P21757 |
◆ Cell & Tissue Lysates | ||
MSR1-800RCL | Recombinant Rat MSR1 cell lysate | +Inquiry |
MSR1-2844HCL | Recombinant Human MSR1 cell lysate | +Inquiry |
MSR1-2288MCL | Recombinant Mouse MSR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSR1 Products
Required fields are marked with *
My Review for All MSR1 Products
Required fields are marked with *