Recombinant Human MSR1 protein, T7/His-tagged
| Cat.No. : | MSR1-44H |
| Product Overview : | Recombinant human CD204 extracellular domain cDNA (77 - 451 aa, Isoform II, derived from BC063878) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 77-451 a.a. |
| Form : | 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEKWETKNCSVSSTNANDITQSLTGKGNDSEEEMRFQEVFMEHMSNMEK RIQHILDMEANLMDTEHFQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSLISLNTTLLDLQLNIENLN GKIQENTFKQQEEISKLEERVYNVSAEIMAMKEEQVHLEQEIKGEVKVLNNITNDLRLKDWEHSQTLRNITLIQG PPGPPGEKGDRGPTGESGPRGFPGPIGPPGLKGDRGAIGFPGSRGLPGYAGRPGNSGPKGQKGEKGSGNTLTPFT KVRLVGGSGPHEGRVEILHSGQWGTICDDRWEVRVGQVVCRSLGYPGVQAVHKAAHFGQGTGPIWLNEVFCFGRE SSIEECKIRQWGTRACSHSEDAGVTCTL |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. May be used as coating or soluble factor for in vitro human CD204 mediated macrophage scavenger receptor activities regulation study.2. May be used for protein-protein interaction assay development.3. As antigen for specific antibody production. |
| Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
| Gene Name | MSR1 macrophage scavenger receptor 1 [ Homo sapiens ] |
| Official Symbol | MSR1 |
| Synonyms | MSR1; macrophage scavenger receptor 1; macrophage scavenger receptor types I and II; CD204; SCARA1; scavenger receptor class A member 1; scavenger receptor class A, member 1; macrophage scavenger receptor type III; macrophage acetylated LDL receptor I and |
| Gene ID | 4481 |
| mRNA Refseq | NM_138716 |
| Protein Refseq | NP_619730 |
| MIM | 153622 |
| UniProt ID | P21757 |
| Chromosome Location | 8p22 |
| Pathway | Phagosome, organism-specific biosystem; Phagosome, conserved biosystem; |
| Function | low-density lipoprotein particle binding; protein binding; receptor activity; scavenger receptor activity; |
| ◆ Recombinant Proteins | ||
| MSR1-1793H | Recombinant Human MSR1 Protein, His&GST-tagged | +Inquiry |
| MSR1-2026H | Recombinant Human MSR1 Protein, His-tagged | +Inquiry |
| RFL29088HF | Recombinant Full Length Human Macrophage Scavenger Receptor Types I And Ii(Msr1) Protein, His-Tagged | +Inquiry |
| Msr1-3275M | Recombinant Mouse Msr1 protein, His-tagged | +Inquiry |
| MSR1-1258H | Recombinant Human MSR1 Protein (Lys77-Val350), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MSR1-2288MCL | Recombinant Mouse MSR1 cell lysate | +Inquiry |
| MSR1-800RCL | Recombinant Rat MSR1 cell lysate | +Inquiry |
| MSR1-2844HCL | Recombinant Human MSR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSR1 Products
Required fields are marked with *
My Review for All MSR1 Products
Required fields are marked with *



