Recombinant Human MSR1 protein, T7/His-tagged
| Cat.No. : | MSR1-44H | 
| Product Overview : | Recombinant human CD204 extracellular domain cDNA (77 - 451 aa, Isoform II, derived from BC063878) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His&T7 | 
| Protein Length : | 77-451 a.a. | 
| Form : | 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. | 
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEKWETKNCSVSSTNANDITQSLTGKGNDSEEEMRFQEVFMEHMSNMEK RIQHILDMEANLMDTEHFQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSLISLNTTLLDLQLNIENLN GKIQENTFKQQEEISKLEERVYNVSAEIMAMKEEQVHLEQEIKGEVKVLNNITNDLRLKDWEHSQTLRNITLIQG PPGPPGEKGDRGPTGESGPRGFPGPIGPPGLKGDRGAIGFPGSRGLPGYAGRPGNSGPKGQKGEKGSGNTLTPFT KVRLVGGSGPHEGRVEILHSGQWGTICDDRWEVRVGQVVCRSLGYPGVQAVHKAAHFGQGTGPIWLNEVFCFGRE SSIEECKIRQWGTRACSHSEDAGVTCTL | 
| Purity : | >90% by SDS-PAGE | 
| Applications : | 1. May be used as coating or soluble factor for in vitro human CD204 mediated macrophage scavenger receptor activities regulation study.2. May be used for protein-protein interaction assay development.3. As antigen for specific antibody production. | 
| Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. | 
| Gene Name | MSR1 macrophage scavenger receptor 1 [ Homo sapiens ] | 
| Official Symbol | MSR1 | 
| Synonyms | MSR1; macrophage scavenger receptor 1; macrophage scavenger receptor types I and II; CD204; SCARA1; scavenger receptor class A member 1; scavenger receptor class A, member 1; macrophage scavenger receptor type III; macrophage acetylated LDL receptor I and | 
| Gene ID | 4481 | 
| mRNA Refseq | NM_138716 | 
| Protein Refseq | NP_619730 | 
| MIM | 153622 | 
| UniProt ID | P21757 | 
| Chromosome Location | 8p22 | 
| Pathway | Phagosome, organism-specific biosystem; Phagosome, conserved biosystem; | 
| Function | low-density lipoprotein particle binding; protein binding; receptor activity; scavenger receptor activity; | 
| ◆ Recombinant Proteins | ||
| MSR1-4609H | Recombinant Human MSR1 Protein (Lys77-Leu451), C-His tagged | +Inquiry | 
| Msr1-4195M | Recombinant Mouse Msr1 Protein, Myc/DDK-tagged | +Inquiry | 
| MSR1-872H | Recombinant Human MSR1 protein, His-tagged | +Inquiry | 
| MSR1-3718H | Recombinant Human MSR1 protein, rFc-tagged | +Inquiry | 
| RFL1120MF | Recombinant Full Length Mouse Macrophage Scavenger Receptor Types I And Ii(Msr1) Protein, His-Tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| MSR1-800RCL | Recombinant Rat MSR1 cell lysate | +Inquiry | 
| MSR1-2844HCL | Recombinant Human MSR1 cell lysate | +Inquiry | 
| MSR1-2288MCL | Recombinant Mouse MSR1 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSR1 Products
Required fields are marked with *
My Review for All MSR1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            