Recombinant Human MSRB2 Protein, GST-tagged

Cat.No. : MSRB2-5667H
Product Overview : Human MSRB2 partial ORF ( NP_036360, 102 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MSRB2 (Methionine Sulfoxide Reductase B2) is a Protein Coding gene. Among its related pathways are Metabolism of proteins and Protein repair. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and peptide-methionine (R)-S-oxide reductase activity. An important paralog of this gene is MSRB3.
Molecular Mass : 36.74 kDa
AA Sequence : KEAGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPDGPGPNGQRFCINSVALKFKPRKH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MSRB2 methionine sulfoxide reductase B2 [ Homo sapiens ]
Official Symbol MSRB2
Synonyms MSRB2; methionine sulfoxide reductase B2; methionine sulfoxide reductase B , MSRB; methionine-R-sulfoxide reductase B2, mitochondrial; CBS 1; CBS1; CGI 131; PILB; pilin-like transcription factor; MSRB; CBS-1; CGI-131; MGC26104;
Gene ID 22921
mRNA Refseq NM_012228
Protein Refseq NP_036360
MIM 613782
UniProt ID Q9Y3D2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MSRB2 Products

Required fields are marked with *

My Review for All MSRB2 Products

Required fields are marked with *

0
cart-icon
0
compare icon