Recombinant Human MSRB2 Protein, GST-tagged
| Cat.No. : | MSRB2-5667H |
| Product Overview : | Human MSRB2 partial ORF ( NP_036360, 102 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | MSRB2 (Methionine Sulfoxide Reductase B2) is a Protein Coding gene. Among its related pathways are Metabolism of proteins and Protein repair. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and peptide-methionine (R)-S-oxide reductase activity. An important paralog of this gene is MSRB3. |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | KEAGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPDGPGPNGQRFCINSVALKFKPRKH |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MSRB2 methionine sulfoxide reductase B2 [ Homo sapiens ] |
| Official Symbol | MSRB2 |
| Synonyms | MSRB2; methionine sulfoxide reductase B2; methionine sulfoxide reductase B , MSRB; methionine-R-sulfoxide reductase B2, mitochondrial; CBS 1; CBS1; CGI 131; PILB; pilin-like transcription factor; MSRB; CBS-1; CGI-131; MGC26104; |
| Gene ID | 22921 |
| mRNA Refseq | NM_012228 |
| Protein Refseq | NP_036360 |
| MIM | 613782 |
| UniProt ID | Q9Y3D2 |
| ◆ Recombinant Proteins | ||
| MSRB2-10149M | Recombinant Mouse MSRB2 Protein | +Inquiry |
| MSRB2-5667H | Recombinant Human MSRB2 Protein, GST-tagged | +Inquiry |
| MSRB2-936H | Recombinant Human MSRB2, 21-182 aa, His-tagged | +Inquiry |
| MSRB2-5753M | Recombinant Mouse MSRB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MSRB2-3796R | Recombinant Rat MSRB2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MSRB2-4108HCL | Recombinant Human MSRB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSRB2 Products
Required fields are marked with *
My Review for All MSRB2 Products
Required fields are marked with *
