Recombinant Human MSRB3 protein, GST-tagged
| Cat.No. : | MSRB3-301275H |
| Product Overview : | Recombinant Human MSRB3 (1-185 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-Leu185 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | MSRB3 methionine sulfoxide reductase B3 [ Homo sapiens ] |
| Official Symbol | MSRB3 |
| Synonyms | MSRB3; methionine sulfoxide reductase B3; deafness, autosomal recessive 74 , DFNB74; methionine-R-sulfoxide reductase B3; DKFZp686C1178; FLJ36866; methionine-R-sulfoxide reductase B3, mitochondrial; DFNB74; |
| Gene ID | 253827 |
| mRNA Refseq | NM_001031679 |
| Protein Refseq | NP_001026849 |
| MIM | 613719 |
| UniProt ID | Q8IXL7 |
| ◆ Recombinant Proteins | ||
| MSRB3-3529H | Recombinant Human MSRB3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MSRB3-301275H | Recombinant Human MSRB3 protein, GST-tagged | +Inquiry |
| MSRB3-655H | Recombinant Human MSRB3 Protein, His-tagged | +Inquiry |
| MSRB3-971H | Recombinant Human MSRB3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MSRB3-5668H | Recombinant Human MSRB3 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MSRB3-4107HCL | Recombinant Human MSRB3 293 Cell Lysate | +Inquiry |
| MSRB3-4106HCL | Recombinant Human MSRB3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSRB3 Products
Required fields are marked with *
My Review for All MSRB3 Products
Required fields are marked with *
