Recombinant Human MST1R protein(871-950 aa), C-His-tagged
Cat.No. : | MST1R-2827H |
Product Overview : | Recombinant Human MST1R protein(Q04912)(871-950 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 871-950 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | VPLKPEEHAIKFEYIGLGAVADCVGINVTVGGESCQHEFRGDMVVCPLPPSLQLGQDGAPLQVCVDGECHILGRVVRPGP |
Gene Name | MST1R macrophage stimulating 1 receptor (c-met-related tyrosine kinase) [ Homo sapiens ] |
Official Symbol | MST1R |
Synonyms | MST1R; macrophage stimulating 1 receptor (c-met-related tyrosine kinase); PTK8, PTK8 protein tyrosine kinase 8 , RON; macrophage-stimulating protein receptor; CD136; CDw136; p185-Ron; MSP receptor; RON variant E2E3; MST1R variant RON30; MST1R variant RON62; soluble RON variant 1; soluble RON variant 2; soluble RON variant 3; soluble RON variant 4; c-met-related tyrosine kinase; PTK8 protein tyrosine kinase 8; RON; PTK8; |
Gene ID | 4486 |
mRNA Refseq | NM_001244937 |
Protein Refseq | NP_001231866 |
MIM | 600168 |
UniProt ID | Q04912 |
◆ Recombinant Proteins | ||
Mst1r-1768M | Recombinant Mouse Mst1r | +Inquiry |
MST1R-3110C | Recombinant Chicken MST1R | +Inquiry |
Mst1r-7081M | Recombinant Mouse Mst1r protein, His & T7-tagged | +Inquiry |
MST1R-10151M | Recombinant Mouse MST1R Protein | +Inquiry |
MST1R-4614H | Recombinant Human MST1R Protein (Met1-Leu571), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MST1R-1962HCL | Recombinant Human MST1R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MST1R Products
Required fields are marked with *
My Review for All MST1R Products
Required fields are marked with *
0
Inquiry Basket