Recombinant Human MST1R protein(871-950 aa), C-His-tagged

Cat.No. : MST1R-2827H
Product Overview : Recombinant Human MST1R protein(Q04912)(871-950 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 871-950 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : VPLKPEEHAIKFEYIGLGAVADCVGINVTVGGESCQHEFRGDMVVCPLPPSLQLGQDGAPLQVCVDGECHILGRVVRPGP
Gene Name MST1R macrophage stimulating 1 receptor (c-met-related tyrosine kinase) [ Homo sapiens ]
Official Symbol MST1R
Synonyms MST1R; macrophage stimulating 1 receptor (c-met-related tyrosine kinase); PTK8, PTK8 protein tyrosine kinase 8 , RON; macrophage-stimulating protein receptor; CD136; CDw136; p185-Ron; MSP receptor; RON variant E2E3; MST1R variant RON30; MST1R variant RON62; soluble RON variant 1; soluble RON variant 2; soluble RON variant 3; soluble RON variant 4; c-met-related tyrosine kinase; PTK8 protein tyrosine kinase 8; RON; PTK8;
Gene ID 4486
mRNA Refseq NM_001244937
Protein Refseq NP_001231866
MIM 600168
UniProt ID Q04912

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MST1R Products

Required fields are marked with *

My Review for All MST1R Products

Required fields are marked with *

0
cart-icon
0
compare icon